Curs valutar


1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


Hibrizi, kituri upgrade cale inversa pentru receptoare optice

  Descriere Pret
KIT UpgradeKIT Upgrade Braun_Group - KIT 2mW

Contine emitator cale inversa 2mW, hibrid RF cale inversa, filtre duplexoare 65/85MHz

Pret : 428.23 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Kit upgradeKit upgrade Braun_Group - KIT 1mW

Contine emitator cale inversa 1mW, hibrid RF cale inversa, filtre duplexoare 65/85MHz

Pret : 333.07 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGY888Hibrid 860MHz Braun_Group - BGY888

Hibrid 860MHz, amplificare 34dB, push-pull, tranzistori NXP, 24VDC

Pret vechi: 30.93 RON
Pret nou:
20.22 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGY787Hibrid 750MHz Braun_Group - BGY787

Hibrid 750MHz, amplificare 21,5dB, push-pull, tranzistori NXP, 24VDC

Pret : 30.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGO807CModul receptor optic Braun_Group - BGO807C

Modul receptie optica SM 1290-1600nm, conector SC/APC, 40-870MHz, 24VDC

Pret : 142.74 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGY588NHibrid 550MHz Braun_Group - BGY588N

Hibrid 550MHz, amplificare 34,5dB, push-pull, tranzistori NXP, 24VDC

Pret : 30.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGE788Hibrid 750MHz Braun_Group - BGY788 / BGE788

Hibrid 750MHz, amplificare 34dB, push-pull, tranzistori NXP, 24VDC

Pret : 30.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
DIODA PINModul receptor optic Braun_Group - DIODA PIN

Modul receptie optica SM 1290-1600nm, conector SC/APC, 40-870MHz

Pret : 71.37 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGD814Hibrid Braun_Group - BGD814

Hibrid BGD814

Pret : 47.58 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGY685AHibrid 650MHz Braun_Group - BGY685A

Hibrid 650 MHz BGY685A

Pret : 30.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
BGY887Hibrid 860MHz Braun_Group - BGY887

Hibrid 860MHz, amplificare 21,5dB, push-pull, tranzistori NXP, 24VDC

Pret : 30.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept