Curs valutar


1 EURO = 4.7199 RON  
1 USD = 4.1541 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148v


HD Media Players, MP3/MP4 Players


NAS Server

2-Bay SATA NAS ServerServer NAS SATA cu 2 sloturi Planet - NAS-7202

Server NAS SATA cu 2 sloturi

Pret : 547.51 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati

HD Media Players

HD Media Player si receptor HD DVB-T DTR5100HD Media Player si receptor HD DVB-T Oubix - DTR5100HD - PVR -1080p

Receptor HD FTA H.264 DVB-T & in format SD & HD.

port, port USB, 2* scart

USB Multimedia Player ( Full HD player 1080p ) - citeste de pe hard disk extern pe portul USB: format video HD 1080p ( Playback Support- mpv, AVI, MPG, MP4, MOV, DivX-HD, xVid-HD, ...).

USB PVR ( Personal video Recorder), inregistreaza programele DVB-T pe HDD extern conectat la portul USB. Compatibil hard Disk extern NTFS sau FAT 32.

MP3 & JPEG File Support

Pret vechi: 159.00 RON
Pret nou:
89.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Receptor digital terestru HD Strong SRT-8110Receptor digital terestru HD DVB-T Strong - SRT-8110

Receptor STRONG DVB-T digital terestru HD, USB PVR, Card Reader, Display, , 2 SCART, 4 RCA, S/PDIF coaxial

Pret vechi: 234.70 RON
Pret nou:
90.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
HD Media Player si receptor HD DVB-T DTR5101HD Media Player si receptor HD DVB-T2 Oubix - DTR5101

Receptor HD FTA H.264 DVB-T + USB Multimedia Player + USB PVR

Pret : 278.47 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Media Player si receptor SD DVB-T DTR4101HSDMedia Player si receptor SD DVB-T Oubix - DTR4101HSD

Receptor SD FTA H.264 DVB-T + USB Multimedia Player + USB PVR

Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati
Media Player si receptor SD DVB-T DTR4102SDMedia Player si receptor SD DVB-T Oubix - DTR4102SD


Receptor SD FTA H.264 DVB-T + USB Multimedia Player + USB PVR


Pret : La cerere
*) Pretul nu contine TVA
Disponibilitate : Sunati

MP4 Players

MP3/MP4 player KNT TM-706MP3/MP4 player KNT - TM-706

MP4 Player, 2GB, suporta MP3/WMA/WAV/AMV/TXT,MPEG-4(AVI), FM Radio, ecran 2" TFT, slot SD-Card

Pret : 59.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3/MP4 player KNT TM-611MP3/MP4 player KNT - TM-611

MP4 player, ecran 1.8" TFT, memorie interna 2Gb, suport SD-Card, MP3/WMA/WMV/AVI/AMV/TXT/JPG, radio incorporat, port USB

Pret : 53.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3/MP4 player KNT TM-708MP3/MP4 player KNT - TM-708

MP4 player, ecran 2" TFT, memorie interna 2Gb, suport SD-Card, MP3/WMA/WMV/AVI/JPG, radio incorporat

Pret : 59.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati

MP3 Player

MP3 player KNT TM-80MP3 player KNT - TM-80

MP3 Player 2GB, suporta WMA, FM Radio, afisaj LCD, ID3 Tag

Pret : 37.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3/MP4 player KNT TM-68MP3 player KNT - TM-68

MP3 Player 2GB, suporta WMA, FM Radio, afisaj LCD, ID3 Tag

Pret : 37.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3 player KNT TM-611EMP3 player KNT - TM-611E

MP3 Player, 2GB, suporta MP3/WAV/TXT, FM Radio, afiseaza 65K culori , ecran 1,5"

Pret : 53.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3 player KNT TM-607MP3 player KNT - TM-607

MP3 Player, 2GB, suporta MP3/WAV/TXT, FM Radio, afiseaza 65K culori , ecran 1,5"

Pret : 52.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MP3 player KNT TM-115MP3 player KNT - TM-115

MP3 Player 2GB, suporta WMA, FM Radio, afisaj LCD, ID3 Tag

Pret : 37.00 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept