Curs valutar


1 EURO = 4.8387 RON  
1 USD = 4.3203 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin


 » Routere wireless

Gigabit Gaming Router AC1200, 4 antennas

Gigabit Ultimate Gaming Router AC1200, 4 antennas 5dB, USB, 4LAN gigabit,

Netis - WF2681 Beacon

stoc limitat
Gigabit Gaming Router Dual band AC1200 ( 300 +900 Mbps)- 4 antennas *5dB, USB,    Built-in 4 gigabit port LAN Switch + 1*Gigabit WAN 
carcasa ABS, 1200Mbps
Beacon N120000 Gaming Router, automatically enable QoS to secure online bandwith, AP, WDS, AP+WDS, Client, Repeater, 

Alte imagini:
Gigabit Gaming Router AC1200, 4 antennasGigabit Gaming Router AC1200, 4 antennasGigabit Gaming Router AC1200, 4 antennas

Pret vechi fara TVA :
166,83 RON

Pret nou fara TVA :
130,58 RON

Pret nou cu TVA :
155,39 RON

Disponibilitate :
In stoc

Standards IEEE 802.11b/g/n 2.4GHz
IEEE 802.11a/n/ac 5GHz
Signal Rate Up to 300Mbps 2.4GHz
Up to 900Mbps 5GHz
Frequency Range 2.4-2.4835GHz;5.180-5.825GHZ
Transmit Power 20dBm(MAX)
Data Transfer Rate

80MHZ(450Mbps, 900Mbps); 

40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)

Wireless Modes AP, Repeater, AP+WDS, WDS, Client, Multi-SSID
Wireless Security WEP/WPA-PSK/WPA2-PSK Encryption
Wireless MAC Filtering
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX
Interface 1 *10/100/1000Mbps Auto MDI/MDIX RJ45 WAN port
4 *10/100/1000Mbps Auto MDI/MDIX RJ45 LAN port
LED Indicators PWR, WPS, SYS, 2.4G, 5G, WAN, LAN1~LAN4
Buttons Default, WPS
Antenna 4 * External fixed 5dBi antenna
Power Supply DC 12V/1A(Output)
Dimensions (L x W x H ) 145 x 155 x 35 mm 
Weight 285g
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control for gaming mode
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec
Others Client Software for Gaming QoS, Multiple SSID, Dynamic DNS, Static Routing, WOL
Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package Contents 1* WF2681
1* 12V/1A Power Adapter
1* Installation CD (for Client Software)
1* Ethernet Cable
1* Cradle
1* Quick Installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept