Curs valutar

04-Jun-2020

1 EURO = 4.8398 RON  
1 USD = 4.3112 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin

ANPC

 » Routere wireless



WF 2631

Gaming Router N300, 3 antennas

Netis - WF2631 beacon

300 Mbps Wireless N Router, 2.4GHz,  802.11 n/g/b, Built-in 4-port Switch; carcasa ABS
Beacon N300 Gaming Router, automatically enable QoS to secure online bandwith, AP, WDS, AP+WDS, Client, Repeater, 

Alte imagini:
WF 2631WF 2631WF 2631





Pret vechi fara TVA :
66,31 RON


Pret nou fara TVA :
56,63 RON

Pret nou cu TVA :
67,38 RON

Disponibilitate :
In stoc

Wireless
Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rates 802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Modes AP, Repeater, AP+WDS, WDS, Client
Wireless Security 64/128-bit WEP,
WPA-PSK/WPA2-PSK (TKIP/AES)
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Hardware
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX
Interfaces 1 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port
4 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port
LED Indicators PWR, WLAN, LAN1-LAN4, WAN, WPS
Buttons WPS, Default
Antennas 3* 5dBi Fixed Antenna
Power Supply DC 9V/500mA (Output)
Software
WAN Type DHCP, Static IP, PPPoE, L2TP, PPTP, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control for gaming mode
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec
Others Client Software for Gaming QoS, Multiple SSID, Dynamic DNS, Static Routing, WOL
Others
Certification FCC, CE 
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90%RH non-condensing
Storage Humidity: 5%~90%RH non-condensing
Package 1* WF2631
1* 9V/500mA Power Adapter
1* Installation CD (for Client Software)
1* Ethernet Cable
1* Cradle
1* Quick Installation Guide
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept