Curs valutar

23-Apr-2019

1 EURO = 4.7581 RON  
1 USD = 4.2268 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality

ANPC

Emitatoare optice Laser pentru retele CATV montabile in rack 19"

 
  Descriere Pret
Emitator Optic nextraCOM CG8626BPEmitator Optic Ortel 31mW nextraCOM - OT8631BP

Emitator laser ORTEL, putere 31mW (14,9dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 47-862MHz, nivel intrare 72-88dB,AGC, 2 hibrizi Philips, alimentare comutatie 110-250V, consum 30W, temperatura operare 0-45°C

Pret : 3,854.06 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic DFB 10mWEmitator Optic DFB 10mW Braun_Group - MW-1000(OT)-10MT

Emitator optic, laser DFB coaxial, putere 10mW (10dBm), 1310nm +/- 20nm, conector SC/APC, intrare RF 45-860 MHz, nivel intrare 75-85dBmV, alimentare 100-260V in comutatie

Pret : 1,332.27 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Maiwei MW-98(OT)-2FPEmitator Optic Braun_Group - MW-98(OT)-2FP

Emitator optic, laser FP, putere 2mW (3dBm), 1310nm +/- 40nm, conector SC/APC, intrare RF 45-450 MHz, nivel intrare 75-85dBmV, alimentare 100-260V in comutatie

Pret : 761.30 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic nextraCOM CG8624BPEmitator Optic Ortel 24mW nextraCOM - OT8624BP

Emitator laser ORTEL, putere 24mW (13,8dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 47-862MHz, nivel intrare 72-88dB,AGC, 2 hibrizi Philips, alimentare comutatie 110-250V, consum 30W, temperatura operare 0-45°C

Pret : 3,235.51 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Maiwei MW-1000(OT)-10mWEmitator Optic Braun_Group - MW-1000(OT)-10mW

Emitator laser ORTEL 1688, putere 10mW (10dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 45-870 MHz / nivel intrare 75-85dBmV, 2 hibrizi Philips power-double, cu circuit pre-distorsion, cu APC, cu ATC, alimentare comutatie 100-260V

Pret : 3,140.35 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator laser ORTEL putere 24mWEmitator laser ORTEL putere 24mW Braun_Group - MW-1000(OT)-24

Emitator laser ORTEL 1688, putere 24mW (13,8dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 45-870 MHz / nivel intrare 75-85dBmV, 2 hibrizi Philips power-double, cu circuit pre-distorsion, cu APC, cu ATC, alimentare comutatie 100-260V

Pret : 3,235.51 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Maiwei MW-1000(OT)-20mWEmitator Optic Braun_Group - MW-1000(OT)-20mW

Emitator laser ORTEL 1688, putere 20mW (13dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 45-870 MHz / nivel intrare 75-85dBmV, 2 hibrizi Philips power-double, cu circuit pre-distorsion, cu APC, cu ATC, alimentare comutatie 100-260V

Pret : 3,211.72 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Maiwei MW-1000(OT)-16mWEmitator Optic Braun_Group - MW-1000(OT)-16mW

Emitator laser ORTEL 1688, putere 16mW (12dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 45-870 MHz / nivel intrare 75-85dBmV, 2 hibrizi Philips power-double, cu circuit pre-distorsion, cu APC, cu ATC, alimentare comutatie 100-260V

Pret : 3,187.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Maiwei MW-1000(OT)-12mWEmitator Optic Braun_Group - MW-1000(OT)-12mW

Emitator laser ORTEL 1688, putere 12mW (10,8dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 45-870 MHz / nivel intrare 75-85dBmV, 2 hibrizi Philips power-double, cu circuit pre-distorsion, cu APC, cu ATC, alimentare comutatie 100-260V

Pret : 3,164.14 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Ortel 20mWEmitator Optic Ortel 20mW nextraCOM - OT8620BP

Emitator laser ORTEL, putere 20mW (13dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 47-862MHz, nivel intrare 72-88dB,AGC, 2 hibrizi Philips, alimentare comutatie 110-250V, consum 30W, temperatura operare 0-45°C

Pret : 3,211.72 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Ortel 16mWEmitator Optic Ortel 16mW nextraCOM - OT8616BP

Emitator laser ORTEL, putere 16mW (12dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 47-862MHz, nivel intrare 72-88dB,AGC, 2 hibrizi Philips, alimentare comutatie 110-250V, consum 30W, temperatura operare 0-45°C

Pret : 3,187.93 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
Emitator Optic Ortel 12mWEmitator Optic Ortel 12mW nextraCOM - OT8612BP

Emitator laser ORTEL, putere 12mW (10,8dBm), 1310nm+/-20nm, conector SC/APC, intrare RF 47-862MHz, nivel intrare 72-88dB,AGC, 2 hibrizi Philips, alimentare comutatie 110-250V, consum 30W, temperatura operare 0-45°C

Pret : 3,164.14 RON
*) Pretul nu contine TVA
Disponibilitate : Sunati
MW-1000(ORT)19"-23mWReleu Optic Braun Group Braun_Group - MW-1000(ORT)19"-23mW

Releu Optic pentru rack 19" (receptor optic cu modul Philips + emitator laser Ortel 23mW)
Nivel optic intrare -8+2dBm, intrare optica 1100-1600nm pe conector SC/APC, 2 iesiri RF 105dBuV cu mufe F, emitator laser Ortel 1310nm, nivel optic iesire 13,6dBm/23mW pe conector SC/APC, alimentare 220V, montabil in rack 19”.

Pret : 3,806.48 RON
*) Pretul nu contine TVA
Disponibilitate : In stoc
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept