Curs valutar


1 EURO = 4.7792 RON  
1 USD = 4.2976 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:


Echipamente pentru receptia si transmisia digitala a canalelor de televiziune pe cablu

  Descriere Pret
Receptor digital TV Cablu WHD-7000NReceptor digital TV Cablu Wellav - WHD-7000N

SET-TOP-BOX HD MPEG-4 pt abonati (DVB-C HD), suporta CAS Irdeto/Conax/WF, iesiri scart, AV, S/PDIF, teletext, afisaj OSD multi lingv.

Cere oferta
Disponibilitate : Sunati
Receptor digital TV Cablu MPEG-2Receptor digital TV Cablu Wellav - WCD-1202

SET-TOP-BOX digital MPEG-2 pt abonati (DVB-C), suporta CAS Irdeto/Conax/WF, iesiri scart, AV, S/PDIF, teletext, afisaj OSD multi lingv.

Cere oferta
Disponibilitate : Sunati
Platforma de bazaPlatforma de baza Wellav - SMP-100

Platforma de baza SMP100, 1U, 19", permite inserarea a maxim 3 module, facilitati : alimentare/multiplexare/TSIP/ASI, capacitate procesare 4GB, include 2xASI in, 2xASI out, 12IP in, 12IP aut

Cere oferta
Disponibilitate : La comanda
Receptor/Decodor digital profesionalReceptor digital profesional Wellav - UMH-160 HD IP

Receptor digital profesional (IRD) .HD, intrare optionala DVB S2/T/C , pt rack 19", multi-decript, prevazut cu doua sloturi CI iesire ASI/SDI,  Intrare/Iesire IP

Cere oferta
Disponibilitate : La comanda
WCD-1205Receptor digital TV Cablu Wellav - WCD-1205

SET-TOP-BOX digital MPEG-2 pt abonati (DVB-C), suporta CAS Irdeto/Conax/WF, iesiri scart, AV, S/PDIF, teletext, afisaj OSD multi lingv, electronic games.

Cere oferta
Disponibilitate : Sunati
Codor  MPEG2 cu MultiplexorEncoder MPEG2 cu Multiplexor Wellav - UMH-260

Encoder MPEG2 cu Multiplexor incorporat,  6 intrari AV CVBS/S +intrare ASI , iesire la alegere,  ASI/SDI

Cere oferta
Disponibilitate : Sunati
Unitate de baza pt Platforma digitala modularaPlatforma digitala modulara de inalta densitate Wellav - DMP-900

Platforma de baza DMP900, 1U, 19", permite inserarea a maxim 6 module, facilitati: alimentare/multiplexare, capacitate procesare 6GB, optiune sursa redundanta

Cere oferta
Disponibilitate : La comanda
Receptor profesionalReceptor profesional Wellav - UMH-160R IP

Receptor profesional 1 intrare DVB-T/S2/C (1 transponder) , 2 sloturi CI multidecript, iesire ASI , IP in/out, RJ 45 pt management

Cere oferta
Disponibilitate : Sunati
Modulator QAM Braun Group UHM-300Modulator QAM Wellav - UMH-300

Modulator QAM, intrare pana la 200Mbps, filtrare PID, tunabil 50-860MHz, selectabil 16/32/64/128/256QAM, control retea

Cere oferta
Disponibilitate : Sunati
Transmodulator QAMTransmodulator QAM Wellav - UMH-160R AD+QAM

Transmodulator QAM , 2 intrari DVB-T/S2/C (2 transpondere) , 4 iesiri RF QAM, 2 sloturi CI multidecript, ASI in/out, RJ-45 pt management

Cere oferta
Disponibilitate : La comanda
Multiplexor DVB Braun Group UMH-510Multiplexor DVB Wellav - UMH-510

Multiplexor DVB 8 intrari ASI pana la 150Mbps, 2 iesiri ASI pana la 80Mbps, control retea

Cere oferta
Disponibilitate : Sunati
Codor MPEG-2Encoder MPEG-2 Wellav - UMH-230

Encoder MPEG-2, pt rack 19", 2 intrari AV, 2 intrari SDI, 3 iesiri ASI, iesire IP

Cere oferta
Disponibilitate : La comanda
SMP-180Receptor satelit profesional multicanal Wellav - SMP-180 SRSCI

Receptor profesional multicanal, include 4 intrari DVB-S2, 4 sloturi CI pt decodare, 2 intrari ASI, 2 iesiri ASI, port RJ45 cu 12 IP in/out, port RJ45 pentru management, multiplexare/remultiplexare canale

Cere oferta
Disponibilitate : La comanda
SMP-180Receptor satelit profesional multicanal Wellav - SMP-180 SRS2

Receptor profesional multicanal, include 12 intrari DVB-S2, 2 intrari ASI, 2 iesiri ASI, port RJ45 cu 12 IP in/out, port RJ45 pentru management, multiplexare/remultiplexare canale

Cere oferta
Disponibilitate : La comanda
Scrambler TS stand-alone Braun Group UHM-600Scrambler TS stand-alone Wellav - UMH-600

Scrambler TS stand-alone, 1 intrare pana la 150Mbps, 2 iesiri codate pana la 60Mbps, suporta pana la 4 DVB Simulcrypt CAS

Cere oferta
Disponibilitate : Sunati
Modulator Edge QAMModulator Edge QAM Wellav - SMP-330 EDGE QAM

Modulator EDGE QAM, 24 iesiri RF QAM (sau 12 iesiri DVB-T), 2 ASI in, 2 ASI out, IP in/out, RJ 45 pt management

Cere oferta
Disponibilitate : La comanda
SMP-260Encoder MPEG2 AV Wellav - SMP-260 SEN2AV6S

Encoder MPEG2 AV cu multiplexor incorporat, 6 intrari AV, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
Transmodulator multi-canal 8 intrariTransmodulator multi-canal 8 intrari Wellav - SMP-330 TRANSMODULATOR

Transmodulator 8 intrari DVB/S2 QPSK/PSK (8 transpondere) , demodulare, multiplexare, 8 iesiri RF QAM (sau 4 iesiri DVB-T), 2 ASI in, 2 ASI out, IP in/out, RJ 45 pt management

Cere oferta
Disponibilitate : La comanda
Gateway ASI/IPGateway ASI/IP Wellav - SMP-350 ASI/IP

Gateway ASI/IP (conversie ASI/IP), suporta 16 streamuri ASI pe intrare, cu conversie la iesire in 12 streamuri IP, si invers (12 streamuri IP in / 12 streamuri ASI out), 2 ASI in, 2 ASI out, RJ-45 pt management

Cere oferta
Disponibilitate : La comanda
Receptor profesional SDReceptor profesional SD Wellav - UMH-160R RL

Receptor profesional SD, 1 intrare DVB-T/S2/C, slot CI multidecript (decodare numai 1 canal MPEG2), ASI out, RJ-45 pt management

Cere oferta
Disponibilitate : La comanda
Modul TSIP pana la 256 intrari / iesiri IPModul TSIP cu 64 intrari si 32 iesiri IP Wellav - TSIP

Modul TSIP cu 64 intrari si 32 iesiri IP

Cere oferta
Disponibilitate : La comanda
Transmodulator COFDMTransmodulator COFDM Wellav - UMH-160COFDM

Transmodulator COFDM , intrare DVB-T/S2/C, iesire RF COFDM, 2CI multidecript, ASI out-in pentru scramblare.

Cere oferta
Disponibilitate : La comanda
Modul 8QAMModul 8xQAM Wellav - WVM8Q

Modul 8xQAM

Cere oferta
Disponibilitate : La comanda
Modul 2-DVB-CIModul 2 sloturi DVB-CI Wellav - WVP2CI

Modul 2 sloturi DVB-CI

Cere oferta
Disponibilitate : La comanda
Modul Encoder 2SD- AVModul Encoder 2SD- AV Wellav - WVEN2SD1

Modul Encoder 2SD- AV

Cere oferta
Disponibilitate : La comanda
SMP-260Encoder H264 HD SDI Wellav - SMP-260 SEN4SDI6H

Encoder H264 HD SDI cu multiplexor incorporat, 6 intrari HD SDI/AV, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
Receptor digital profesionalReceptor digital profesional Wellav - UMH-150 IP

Receptor digital profesional (IRD) intrare DVB S/T/C/S2, pt rack 19", multi-decript, prevazut cu doua sloturi CI, intrare ASI, iesire ASI, iesire AV, Intrare/Iesire IP

Cere oferta
Disponibilitate : La comanda
Receptor profesional SD/HDReceptor profesional SD/HD Wellav - UMH-160R

Receptor profesional SD/HD, 1 intrare DVB-T/S2/C (1 transponder) , 2 sloturi CI multidecript, iesire ASI, RJ 45 pt management

Cere oferta
Disponibilitate : La comanda
Modul 4-ASIModul 4xASI Wellav - WVIO4ASI

Modul 4 x ASI intrari/iesiri

Cere oferta
Disponibilitate : La comanda
Modul 4 intrari DVB-S/S2Modul 4 intrari DVB-S/S2 Wellav - WVR4S2

Modul 4 intrari DVB-S/S2

Cere oferta
Disponibilitate : La comanda
Modul Encoder 2xSD H264 si SDIModul Encoder 2xSD H264 si SDI Wellav - WVEN2H2642

Modul Encoder 2 x SD H264 SDI

Cere oferta
Disponibilitate : La comanda
Modul 4 intrari DVB-CModul 4 intrari DVB-C Wellav - WVR4C

Modul 4 intrari DVB-C

Cere oferta
Disponibilitate : La comanda
Modul Encoder 2SD si HD, H264 si SDIModul Encoder 2SD si HD, H264 si SDI Wellav - WVEN2H2642

Modul Encoder 2 x SD&HD  H264 si SDI

Cere oferta
Disponibilitate : La comanda
Sistem profesional WF CAS Wellav - BG-SOFT2

Sistem profesional WF CAS (Conditional Access System) & SMS (Subscriber Management System), conform DVB Simulcrypt, software instalat pe server DELL pt rack 19", licenta pana la 2.000 abonati

Cere oferta
Disponibilitate : La comanda
Modul 4 intrari DVB-TModul 4 intrari DVB-T Wellav - WVR4T

Modul 4 intrari DVB-T

Cere oferta
Disponibilitate : La comanda
SMP-260Encoder MPEG2 AV/SDI Wellav - SMP-260 SEN2SDI6S

Encoder MPEG2 AV/SDI cu multiplexor incorporat, 6 intrari AV/SDI, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
SMP-180Receptor satelit profesional multicanal Wellav - SMP-180 SRCCI

Receptor profesional multicanal, include 4 intrari DVB-C, 4 sloturi CI pt decodare, 2 intrari ASI, 2 iesiri ASI, port RJ45 cu 12 IP in/out, port RJ45 pentru management, multiplexare/remultiplexare canale

Cere oferta
Disponibilitate : La comanda
SMP-270Encoder _ H264 HD Wellav - SMP-270-12_

Encoder H264 HD cu multiplexor incorporat, 12 intrari , 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
Modul transcodare la MPEG2 (4 programe)Modul transcodare la MPEG2 (4 programe) Wellav - TC2

Modul transcodare la MPEG2 (4 programe)

Cere oferta
Disponibilitate : La comanda
Modul scrambling, gigabit, 12 streamuriModul scrambling, gigabit, 12 streamuri Wellav - WVSCRG12

Modul scrambling, gigabit, suporta pana la 12 streamuri

Cere oferta
Disponibilitate : La comanda
SMP316Modulator QAM pentru canale IP Wellav - SMP-316-00

Modulator EDGE QAM pentru 256 intrari IP, 8 iesiri RF QAM (programabile, neadiacente)
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
Smart Card Wellav - BG-CARD

Smart Card pt set-top-box abonat

Cere oferta
Disponibilitate : La comanda
Sistem profesional WF CAS Wellav - BG-SOFT20

Sistem profesional WF CAS (Conditional Access System) & SMS (Subscriber Management System), conform DVB Simulcrypt, software instalat pe server DELL pt rack 19", licenta pana la 20.000 abonati

Cere oferta
Disponibilitate : La comanda
Upgrade CAS si SMS Wellav - BG-UP20

Upgrade CAS & SMS pt 20.000 abonati suplimentari (dar pana la un total de 200.000 abonati)

Cere oferta
Disponibilitate : La comanda
Modul Encoder 2 x SDI MPEG2 / AVModul Encoder 2 x SDI MPEG2 / AV Wellav - WVEN2SDI

Modul Encoder 2 x SDI MPEG2 / AV

Cere oferta
Disponibilitate : La comanda
Upgrade CAS si SMS Wellav - BG-UP2

Upgrade CAS & SMS pt 2.000 abonati suplimentari (dar pana la un total de 20.000 abonati)

Cere oferta
Disponibilitate : La comanda
SMP-180Receptor satelit profesional multicanal Wellav - SMP-180 SRC

Receptor profesional multicanal, include 12 intrari DVB-C, 2 intrari ASI, 2 iesiri ASI, port RJ45 cu 12 IP in/out, port RJ45 pentru management, multiplexare/remultiplexare canale

Cere oferta
Disponibilitate : La comanda
SMP270Encoder _ H264 HD Wellav - SMP-270-4_

Encoder H264 HD cu multiplexor incorporat, 4 intrari , 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
SMP-260Encoder MPEG2 AV Wellav - SMP-260 SEN2AV12S

Encoder MPEG2 AV cu multiplexor incorporat, 12 intrari AV, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
Modul transcodare la MPEG-4 (4 programe)Modul transcodare la MPEG-4 (4 programe) Wellav - TC4

Modul transcodare la MPEG-4 (4 programe)

Cere oferta
Disponibilitate : La comanda
SMP-270Encoder _ H264 HD Wellav - SMP-270-8_

Encoder H264 HD cu multiplexor incorporat, 8 intrari , 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management

Cere oferta
Disponibilitate : La comanda
SMP-316Modulator QAM pentru canale IP Wellav - SMP-316-05

Modulator EDGE QAM pentru 256 intrari IP, 16 iesiri RF QAM (programabile, neadiacente), codare canale inclusa
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-316Modulator QAM pentru canale IP Wellav - SMP-316-02

Modulator EDGE QAM pentru 256 intrari IP, 24 iesiri RF QAM (programabile, neadiacente)
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-340Insertor 8 canale Wellav - SMP-340-11

Encoder 8 intrari SC CVBS si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-316Modulator QAM pentru canale IP Wellav - SMP-316-01

Modulator EDGE QAM pentru 256 intrari IP, 16 iesiri RF QAM (programabile, neadiacente)
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-316Modulator QAM pentru canale IP Wellav - SMP-316-04

Modulator EDGE QAM pentru 256 intrari IP, 8 iesiri RF QAM (programabile, neadiacente), codare canale inclusa
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-316Modulator QAM pentru canale IP Wellav - SMP-316-03

Modulator EDGE QAM pentru 256 intrari IP, 32 iesiri RF QAM (programabile, neadiacente)
Bazat pe platforma SMP100 dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP340Insertor 2 canale Wellav - SMP-340-00

Encoder 2 intrari MPEG-2/H264 si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
EN2AV-2S+Modul encoder 2 intrari AV MPEG2 Wellav - EN2AV-2S+

Modul encoder 2 intrari AV MPEG2 - EN2AV-2S+

Cere oferta
Disponibilitate : La comanda
SMP-340Insertor 8 canale Wellav - SMP-340-03

Encoder 8 intrari MPEG-2/H264 si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-340Insertor 4 canale Wellav - SMP-340-01

Encoder 4 intrari MPEG-2/H264 si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-340Insertor 4 canale Wellav - SMP-340-10

Encoder 4 intrari SC CVBS si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
SMP-340Insertor 6 canale Wellav - SMP-340-02

Encoder 6 intrari MPEG-2/H264 si modulare QAM.
Bazat pe platforma SMP100 echipamentul este destinat sa insereze noi provrame TV in grila digitala deja existenta.
Platforma dispune de 3 sloturi pentru module, multiplexor incorporat, 2 intrari ASI, 2 iesiri ASI, port RJ45 12 IP in/out, port RJ45 pentru management, capacitate de procesare 4GB.

Cere oferta
Disponibilitate : La comanda
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept