Curs valutar


1 EURO = 4.7537 RON  
1 USD = 4.3082 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


Echipamente de crimpat si sertizat, cleste profesional de sertizare, tester retea

  Descriere Pret
Braun Group NF-308 Network TesterTester Retea multifunctional NF-308 Braun Group - NF-308
Tester retea multifunctional NF-308, conectori RJ45/RJ11/BNC/USB, afisaj LCD, wiremap pentru cabluri de date pe RJ45 si coaxiale pe BNC, cable tracker pentru cabluri date CAT5/CAT6 pe RJ45, cabluri telefonice pe RJ11 sau coaxiale pe BNC, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, determina distanta pana la locul unde cablul este intrerupt sau scurtcircuitat, masoara lungimea cablurilor de date pe RJ45 pana la 1000m, inchidere automata cu intarziere, alimentare de la o baterie Alkalina de 9V + o baterie Alkalina de 9V pt tracker.
Pret vechi 237.69 RON
Pret nou
218.67 RON
*) Pretul nu contine TVA
cuTVA: 260.22 RON
Disponibilitate : Sunati
Network Cable Tester - NF8108Tester Retea cu afisaj LCD Braun Group - NF-8108

Tester retea NF-8108, conector RJ45, afisaj LCD, wiremap pana la 300m pentru cabluri de date pe RJ45, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, masoara lungimea cablurilor si determina distanta pana la locul unde cablul este intrerupt sau scurtcircuitat, inchidere automata cu intarziere, alimentare de la 4 baterii Alkaline 1,5V, functie de autoverificare si compensare automata a oricaror modificari in capacitatea bateriei sau a temperaturii mediului ambiant.

Pret vechi 213.92 RON
Pret nou
166.38 RON
*) Pretul nu contine TVA
cuTVA: 197.99 RON
Disponibilitate : Sunati
NF-8601Tester Retea NF-8601 Braun Group - NF-8601
Tester retea NF-8601 pentru cabluri : cat5, cat6, coaxiale, telefonice, cu functie POE (decteaza pinii cu tensiune pe ei, si valoarea tensiunii), test PING, Wiremap, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, crosstalk test pentru indepartarea problemelor de viteza redusa, identifica cablul urmarit fara a-l desizola, masoara lungimea cablurilor de date/coaxiale/telefonie (distanta=20-2000m), metoda Capacitiva, precizia de masurare 3%, calibrare pt un anumit tip de cablu, lungime cablu calibrare peste 10m (se pot salva maxim 9 calibrari), localizeaza cu precizie pozitia unde cablul este intrerupt sau scurtcircuitat, detector tensiune in cabluri (50V-1000V), afisaj LCD 2,8”, functie de memorare, import/export date catre calculator, inchidere automata cu intarziere, baterie Lithium 3,7V/1,8A reincarcabila, alarma baterie consumata, temperatura de operare -10+60 grade Celsius, umiditate 20%-70%
Pret : 522.91 RON
*) Pretul nu contine TVA
cuTVA: 622.26 RON
Disponibilitate : Sunati
NF-8200Ethernet Cable Tester & Fault locator Braun Group - NF-8200 -RJ45 & RJ11

Tester retea & Fault Locator NF-8200, conectori RJ45/RJ11, afisaj LCD, wiremap pentru cabluri date pe RJ45/RJ11, masoara lungimea cablurilor pe RJ11/RJ45 pana la 2500m, abilitate anti-jamming, cable tracker pentru cabluri date pe RJ11/RJ45, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, localizeaza cu acuratete punctele de intrerupere sau scurtcircuit, crosstalk test pt probleme de viteza redusa, functie de memorare si stocare, temperaturi de operare -20+60 grade Celsius, alimentare de la 4 baterii alkaline tip AA de 1,5V si o baterie Alkalina de 9V pt tracker.

Produsul se livreaza fara baterii.

Vezi fisa tehnica in sectiunea Download

Pret vechi 313.27 RON
Pret nou
265.26 RON
*) Pretul nu contine TVA
cuTVA: 315.66 RON
Disponibilitate : Sunati
Crimping tool 10P10C, RJ45, RJ12, RJ11 Braun Group TL-200RCleste sertizat 10P10C, RJ45, RJ12, RJ11 Braun Group - HT-200R / TL-200R

Cleste sertizat conectori 10P10C, RJ45/8P8C, RJ12/6P6C, RJ11/6P4C, 4P4C, 4P2C, desizolat si taiat cablu, cu clichet

Pret : 71.31 RON
*) Pretul nu contine TVA
cuTVA: 84.85 RON
Disponibilitate : Sunati
HT-3141AUnelta sertizat tip Krone Punch Down Tool Insertion UTP & FTP Braun Group - To-Krone/ HT-3141A

Unelta sertizat tip Krone: cu gheara de extractie, pentru patch panel & keyston
KRONE Network Tool KD-1 Punch Down Tool Insertion Cable UTP/FTP Keyston & patch panel Rj45 


Pret vechi 19.01 RON
Pret nou
15.21 RON
*) Pretul nu contine TVA
cuTVA: 18.10 RON
Disponibilitate : Sunati
Tester Retea Braun Group NF-468Tester Retea Braun Group - NF-468
Tester retea cablu UTP/FTP, mufe RJ45 RJ11 RJ12 
Pret vechi 42.78 RON
Pret nou
23.77 RON
*) Pretul nu contine TVA
cuTVA: 28.28 RON
Disponibilitate : Sunati
Cleste sertizare Braun Group TL-314B-TL-14BUnealta insertie 110 Braun Group - TL-110

Unealta insertie/sertizare tip 110/88

Pret : 30.90 RON
*) Pretul nu contine TVA
cuTVA: 36.77 RON
Disponibilitate : Sunati
NF-388Tester Retea NF-388 Braun Group - NF-388

Tester retea multifunctional NF-388, conectori RJ45/RJ11/BNC/USB , afisaj LCD, wiremap pentru cabluri de date pe RJ45 si coaxiale pe BNC, cable tracker pentru cabluri date CAT5/CAT6 pe RJ45, telefonice pe RJ11, coaxiale pe BNC, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, determina distanta pana la locul unde cablul este intrerupt sau scurtcircuitat, masoara lungimea cablurilor de date pe RJ45, cu 8 testere remote pentru 8 cabluri simultan, memorie pentru datele de calibrare, inchidere automata cu intarziere, alimentare de la o baterie Alkalina de 9V + o baterie Alkalina de 9V pt tracker

Pret vechi 285.22 RON
Pret nou
275.71 RON
*) Pretul nu contine TVA
cuTVA: 328.10 RON
Disponibilitate : Sunati
NF-8601WTester Retea NF-8601W Braun Group - NF-8601W

Tester retea NF-8601W pentru cabluri : cat5, cat6, coaxiale, telefonice, cu functie POE (decteaza pinii cu tensiune pe ei, si valoarea tensiunii), test PING, Wiremap, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, crosstalk test pentru indepartarea problemelor de viteza redusa, identifica cablul urmarit fara a-l desizola, masoara lungimea cablurilor de date/coaxiale/telefonie (distanta=20-2000m), metoda Capacitiva, precizia de masurare 3%, calibrare pt un anumit tip de cablu, lungime cablu calibrare peste 10m (se pot salva maxim 9 calibrari), localizeaza cu precizie pozitia unde cablul este intrerupt sau scurtcircuitat, detector tensiune in cabluri (50V-1000V), cu 8 testere remote pentru 8 cabluri simultan, afisaj LCD 2,8”, functie de memorare, import/export date catre calculator, inchidere automata cu intarziere, baterie Lithium 3,7V/1,8A reincarcabila, alarma baterie consumata, temperatura de operare -10+60 grade Celsius, umiditate 20%-70%

Pret : 594.21 RON
*) Pretul nu contine TVA
cuTVA: 707.11 RON
Disponibilitate : Sunati
HT-2008RCleste sertizat RJ45, RJ12, RJ11 Braun Group - HT-2008R / FLT-200R

Cleste sertizat conectori RJ45/8P8C, RJ12/6P6C, RJ11/6P4C, 4P4C, 4P2C, desizolat si taiat cablu, cu clichet

Pret : 48.49 RON
*) Pretul nu contine TVA
cuTVA: 57.70 RON
Disponibilitate : Sunati
Unelta standard de sertizat 110 Braun Group TO-1001Unelta standard de sertizat 110, HT-110 Braun Group - TO-1001 / HT-110 / FLT012

Unelta standard de sertizat 110, TO-1001 / HT-110 / FLT-012

Pret : 30.90 RON
*) Pretul nu contine TVA
cuTVA: 36.77 RON
Disponibilitate : Sunati
NF-816Underground wire locator Braun Group - NF-816

Detector de cabluri neconectate la tensiune, sub pamant sau in pereti, adancimea maxima de detectie 0,8m.
Echipamentul este format din transmitator si receptor. Transmitatorul se leaga la capatul cablului ce trebuie detectat ( electric, coaxial, de date, telefonic, conducte metalice). Receptorul este prevazut cu o antena de detectie, indicator LED si mufa pentru casti externe (incluse). Atat emitatorul cat si receptorul se alimenteaza de la baterii de 9VDC (neincluse). Temperaturi de operare -10+50 grade Celsius

Pret : 209.64 RON
*) Pretul nu contine TVA
cuTVA: 249.47 RON
Disponibilitate : Sunati
NF-300Tester Retea NF-300 Braun Group - NF-300

Tester retea multifunctional NF-300, conectori RJ45/RJ11/BNC/USB, afisaj LCD, wiremap pentru cabluri pe RJ45, RJ11 coaxiale pe BNC si cablu USB, cable tracker pentru cabluri date CAT5/CAT6 pe RJ45 UTP/STP, cabluri telefonice pe RJ11 sau coaxiale pe BNC, abilitate anti-jamming, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, determina distanta pana la locul unde cablul este intrerupt sau scurtcircuitat, crosstalc test pt probleme de viteza redusa, masoara lungimea cablurilor de date pe RJ45 si coaxiale pe BNC, functie de memorare si stocare, inchidere automata cu intarziere, alimentare de la o baterie Alcalina de 9V + o baterie Alcalina de 9V pt tracker, low battery display.

Pret vechi 294.73 RON
Pret nou
275.71 RON
*) Pretul nu contine TVA
cuTVA: 328.10 RON
Disponibilitate : Sunati
NF-868Tester Retea NF-868 Braun Group - NF-868

Tester retea & cable length tester NF-868, conectori RJ45/RJ11/BNC/USB, afisaj LCD, wiremap pentru cabluri pe RJ45, RJ11 coaxiale pe BNC si cablu USB, identifica cablurile cu scurtcircuit intrerupte sau cross connection, crosstalk test pentru indepartarea problemelor de viteza redusa, identifica cablul urmarit fara a-l desizola, masoara lungimea cablurilor de date/coaxiale/telefonie/USB, localizeaza cu precizie pozitia unde cablul este intrerupt sau scurtcircuitat, functie de memorare si stocare, inchidere automata cu intarziere, alimentare de la o baterie Alkalina de 9V + o baterie Alkalina de 9V pt receiver, functie de autoverificare si compensare automata a oricaror modificari in capacitatea bateriei sau a temperaturii mediului ambiant.

Pret vechi 366.03 RON
Pret nou
356.53 RON
*) Pretul nu contine TVA
cuTVA: 424.27 RON
Disponibilitate : Sunati
Dezizolator pentru UTP/STP Braun Group TL-318MDezizolator pentru UTP/ STP Braun Group - TL-318M (SL-KNIFE)

Dezizolator pentru  UTP/STP, cap standard 110/88

Pret : 9.32 RON
*) Pretul nu contine TVA
cuTVA: 11.09 RON
Disponibilitate : Sunati
NF-268RJ45-RJ11-BNC Wire tracker Braun Group - NF-268

Detector cabluri de date UTP/STP atat conectate la echipamente in functiune cat si neconectate, wiremap pentru cabluri pe RJ45, RJ11 coaxiale pe BNC. Echipamentul este format din transmitator (se leaga la capatul cablului ce trebuie detectat) si receptor (scaner). Receptorul este prevazut cu difuzor si buton ajustare volum sunet detectie, mufa pentru casti externe (incluse). Atat emitatorul cat si receptorul se alimenteaza de la baterii de 9VDC (neincluse). Temperaturi de operare -10+50 grade Celsius

Pret vechi 212.97 RON
Pret nou
206.79 RON
*) Pretul nu contine TVA
cuTVA: 246.08 RON
Disponibilitate : Sunati
Cleste dezizolat 501 Braun Group TO-3001Cleste dezizolat 501 Braun Group - TO-3001

Cleste dezizolat 501

Pret : 10.46 RON
*) Pretul nu contine TVA
cuTVA: 12.45 RON
Disponibilitate : Sunati
HT-2008Cleste sertizat 10P10C, RJ45, RJ12, RJ11 Braun Group - HT-2008 / FLT-200

Cleste sertizat conectori RJ45/8P8C, RJ12/6P6C, RJ11/6P4C, 4P4C, 4P2C, desizolat si taiat cablu, fara clichet

Pret : 44.21 RON
*) Pretul nu contine TVA
cuTVA: 52.61 RON
Disponibilitate : Sunati
Unelta sertizat 5 perechi Braun Group TO-1005Unelta sertizat 5 perechi Braun Group - TO-1005

Unelta sertizat 5 perechi

Pret : 220.57 RON
*) Pretul nu contine TVA
cuTVA: 262.48 RON
Disponibilitate : Sunati
WS-101SCleste dezizolat conductor cupru Braun Group - WS-101S / FLT-006

Cleste desizolat conductor cupru diametru 0,6/0,8/1,0/1,3/1,6/2,0/2,6mm (AWG 22/20/18/16/14/12/10)

Pret : 34.23 RON
*) Pretul nu contine TVA
cuTVA: 40.73 RON
Disponibilitate : Sunati
Cleste cu falci lungi 120mmCleste cu falci lungi 120mm INTEK - GT-20263

Cleste cu falci lungi 120mm

Pret : 24.50 RON
*) Pretul nu contine TVA
cuTVA: 29.16 RON
Disponibilitate : Sunati
Cleste de sertizat cu 2 capete RJ12&RJ45 Braun Group TO-2004Cleste de sertizat cu 2 capete RJ12&RJ45 Braun Group - TO-2004

Cleste de sertizat cu 2 capete RJ12 & RJ45

Pret : 35.65 RON
*) Pretul nu contine TVA
cuTVA: 42.43 RON
Disponibilitate : Sunati
Desizolator pentru cabluri de date Mondo Style SL-KNIFEDesizolator pentru cabluri de date Mondo Style - SL-KNIFE

Desizolator de plastic pentru cabluri de date

Pret : 4.75 RON
*) Pretul nu contine TVA
cuTVA: 5.66 RON
Disponibilitate : Sunati
Cleste combinat 130mmCleste combinat 130mm INTEK - GT-20267

Cleste combinat 130mm

Pret : 24.50 RON
*) Pretul nu contine TVA
cuTVA: 29.16 RON
Disponibilitate : Sunati
NF-889Tester Retea multifunctional NF-889 Braun Group - NF-889
Detector de cabluri neconectate la tensiune, sub pamant sau in pereti. Wiremap pentru cabluri de date pe conector RJ45.
Echipamentul este format din transmitator de ton cu frecventa de 1000Hz si receptor. Transmitatorul se leaga la capatul cablului ce trebuie detectat ( electric, de date, telefonic, conducte metalice). Receptorul (scaner) este prevazut cu o antena de detectie, indicator LED si mufa jack pentru casti externe (incluse). Atat emitatorul cat si receptorul se alimenteaza de la baterii de 9VDC (neincluse). Temperaturi de operare -10+50 grade Celsius
Pret : 137.86 RON
*) Pretul nu contine TVA
cuTVA: 164.05 RON
Disponibilitate : Sunati
Unelta A de sertizat RJ45 Braun Group TO-200AUnelta A de sertizat RJ45 Braun Group - TO-200A


Unelta A de sertizat RJ45


Pret : 36.13 RON
*) Pretul nu contine TVA
cuTVA: 42.99 RON
Disponibilitate : Sunati
Cleste cu falci lungi 145mmCleste cu falci lungi 145mm INTEK - GT-20265

Cleste cu falci lungi 145mm

Pret : 24.50 RON
*) Pretul nu contine TVA
cuTVA: 29.16 RON
Disponibilitate : Sunati
NF-468BLTester Retea Braun Group - NF-468BL

Tester retea cablu UTP/FTP/telefonic/coaxial, mufe RJ45/RJ11/BNC, alimentare cu baterie 9V

Pret : 27.33 RON
*) Pretul nu contine TVA
cuTVA: 32.53 RON
Disponibilitate : Sunati
NF-8601STester Retea NF-8601S Braun Group - NF-8601S
Tester retea NF-8601S pentru cabluri : cat5, cat6, cat6A, cat7, coaxiale, telefonice, electrice, cu functie POE (decteaza pinii cu tensiune pe ei, si valoarea tensiunii), test PING, Wiremap cu distanta pana la defect, identifica cablurile cu scurtcircuit, intrerupte sau cross connection, crosstalk test pentru indepartarea problemelor de viteza redusa, identifica cablul urmarit fara a-l desizola, masoara lungimea cablurilor de date/coaxiale/telefonie (distanta=1-1000m) metoda TDR, precizia de masurare 3%, calibrare pt un anumit tip de cablu pentru o masuratoare cat mai precisa, lungime cablu calibrare minim 50m, localizeaza cu precizie pozitia unde cablul este intrerupt sau scurtcircuitat, detector tensiune in cabluri (50V-1000V), afisaj LCD 2,8”, functie de memorare, card de memorie inclus, import/export date catre calculator, inchidere automata cu intarziere, baterie Lithium 3,7V/1,8A reincarcabila, alarma baterie consumata, temperatura de operare -10+60 grade Celsius, umiditate 20%-70%
Pret : 594.21 RON
*) Pretul nu contine TVA
cuTVA: 707.11 RON
Disponibilitate : Sunati
Tester cablu de cupru UTP, FTP (RJ45), linii telefonice(RJ11Tester cablu de cupru UTP, FTP (RJ45), linii telefonice(RJ11 SHUNSHENG - SC6106A

Tester cablu de cupru UTP, FTP (RJ45), linii telefonice(RJ11

Pret : 92.00 RON
*) Pretul nu contine TVA
cuTVA: 109.48 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept