Curs valutar

22-Oct-2019

1 EURO = 4.7592 RON  
1 USD = 4.2607 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » DVR-uri AHD - TVI



EN-6104

DVR AHD 4 Camere Grain GM8283

Braun Group - EN-6104

DVR AHD 4 canale, 720P Real Time Recording, 4ch 720P Real Time Playback, 4ch Video in / 1ch Video out , 4ch Audio in / 1ch Audio out, With USB Mouse, 1HDD,DC12V/2A adapter,remote controller 






Pret vechi fara TVA :
274,13 RON


Pret nou fara TVA :
233,20 RON

Pret nou cu TVA :
277,51 RON

Disponibilitate :
Sunati

Optional:

HDD-1TB - Seagate Surveillance SV-35(ST1000VX000) 3.5", SATA III 600, 64MB Cache

HDD-2TB - Seagate Surveillance SV-35(ST2000VX000) 3.5", SATA III 600, 64MB Cache

HDD-3TB - Seagate Surveillance SV-35(ST3000VX000) 3.5", SATA III 600, 64MB Cache

 

Features 
4CH 720P real time AHD DVR
VGA simultaneous video output
Support HD video signal recording, storage, playback and transport
Low latency system in favour of real-time HD video image processing
Support six operations at the same time, recording, playback, network transmission, backup, IP PTZ control etc
Support IE and client, remote parameter settings / convenient remote network access function
  without need to apply for any domain names, plug and play
Support Multi-language OSD

 

Model EN-6104
Chipset Grain GM8283
Compression H.264 Standard compression
Operation Embedded  Linux
Image  coding-control Image edit adjustable,both changable and fix stream optional
Dual stream  Can be set up in each channel
Monitor image quality 720P (1280×720)
Image dynamic detection Multiple detection areas in each channel 
Recording frame rate 720P 25FPS/CH(PAL)  30FPS/CH(NTSC)
Image playback quality 720P  TOTAL:120FPS
Video mode Support manual, automatic, dynamic monitoring, alarm trigger video mode 
Backup mode U disk, USB portable disk, USB burn, Network storage and backup
Operate mode Mouse ,Remote controler   Front Panel Control
login locally admin and password
Save recording local hard disk and network
External
interface
Video input 720P@25/30FPS  Support:50/60FPS  4*BNC
Audio input 1*RCA
Video output 1*BNC,1*VGA
Audio output 1*RCA
Network interface 10M/100M base-T Ethernet (RJ-45) 
USB connect port 2 * USB 2.0 
RS485 RS485*1
Alarm input no
Alarm output no
Hard disk Internal HDD 2 SATA HDD port
Maximum capacity Maximum 6TB each SATA
Cell phone monitoring Support  iPhone,iPad, Android,and 3G
Power  12V/4A
Operating Temperature  -10℃~+55℃
Operating  humidity 10%-90%
DVR size 335*250*50mm
Weight ≤3.5kg(without HDD)

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept