Curs valutar

19-Oct-2019

1 EURO = 4.7556 RON  
1 USD = 4.2732 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

Exceptand produsele Hikvision, celelalte se pot comanda doar la sediul din Timisoara.


Camere de supraveghere video analogice

 
  Descriere Pret
TR40VA-CM138-ICR1000TVL- SONY CMOS Camera IP66, IR60m Braun Group - TR40VA-CM138-ICR

Camera de supraveghere cu infrarosu , 1000TVL, 1,3 Mpx, pentru exterior, senzor 1/3" SONY IMX225 + FH8523 , with IR-CUT , distanta IR 60m, IP66, 2.8-12mm Manual zoom Lens

Pret vechi 203.00 RON
Pret nou
63.40 RON
*) Pretul nu contine TVA
cuTVA: 75.45 RON
Disponibilitate : Sunati
AHD-CS30-200Camera exterior AHD 2Mpx, IR25m Braun Group - AHD-CS30-200

1/3" SONY 2.0 Megapixel CMOS Sensor/1080P

Weatherproof IR Camera
30 pcs*¢5mm IR LED
IR Distance 25M 3-Axis Bracket Hidden cable design Built-in 3.6mm ICR Lens Water resistance:IP66 Weight:0.7Kg

Pret vechi 175.00 RON
Pret nou
76.50 RON
*) Pretul nu contine TVA
cuTVA: 91.04 RON
Disponibilitate : Sunati
DF-5442RNCamera de supraveghere Dome Performer - DF-5442RN

1/3"sony CCD, 420TVL, 4~9mm varifocal l lens, φ8×30PCS IR LEDs, 30~35m IR distance 

Pret vechi 202.00 RON
Pret nou
31.00 RON
*) Pretul nu contine TVA
cuTVA: 36.89 RON
Disponibilitate : Sunati
SAD01PTZ Decoder Braun Group - SAD-01

SAD-01

PTZ Lens Decoder

- Outdoor & indoor intelligent controller
- Multi-protocol receiver/driver
- AC 220V (or 24V) 10% 50HZ/60HZ
- 150mA(AC220V input) 30W

Pret vechi 140.00 RON
Pret nou
54.50 RON
*) Pretul nu contine TVA
cuTVA: 64.86 RON
Disponibilitate : Sunati
AHD-CI20E-200ECamera exterior 2Mpx, IR20m Braun Group - AHD-CI20E-200E

Camera de supraveghere AHD 2Mpx cu infrarosu, senzor CMOS: OV2710+NVP2441H, 1/3" 1080p , IR-CUT    

Weatherproof IR Camera
24 pcs*¢5mm IR LED
IR Distance 20M

3-Axis Bracket Hidden cable design

Built-in 3.6mm ICR Lens
Water resistance:IP66

Weight:0.5Kg

Pret vechi 126.00 RON
Pret nou
92.00 RON
*) Pretul nu contine TVA
cuTVA: 109.48 RON
Disponibilitate : Sunati
HSP-CM1099Camera camuflata PIR 800 TVL Braun Group - HSP-CM1099

Camera Analogica HSP-CM1099 tip PIR camuflaj 800 linii, lentila 3.7mm

 

  • HSP-CM1099
  • Camera camuflata in forma de detector PIR
  • CMOS 1/3 ''
  • 0.8Lux / F2.0
  • Resolution: 800 lines
  • Lens: 3.7mm
  • 12V DC, 50mA
  • Dimensions: 70x50x120mm
Pret vechi 84.00 RON
Pret nou
23.30 RON
*) Pretul nu contine TVA
cuTVA: 27.73 RON
Disponibilitate : Sunati
DS-2CE16C2T-IT5Camera TurboHD Hikvision EXIR 1Mpx Bullet Hikvision - DS-2CE16C2T-IT5

•1 MegaPixel camera video HD Ready 720P, TurboHD rezolutie 1280x720 pixeli 25 fps
• iluminator IR automat 80 metri cu optimizare IRCut Day&Night
• DNR, Smart IR, BLC, SmartIR, EXIR
• obiectiv fix 3.6mm 76 grade deschidere
• utilizare interior/exterior grad de protectie la intemperii IP66
• cablare cu cablu coaxial pana la 500 metri si conectori BNC
• temperaturi de utilizare -40C pana la +60C
• alimentare 12Vcc/1A; functioneaza impreuna cu DVR-urile HIKVISION TurboHD.

Pret : 213.00 RON
*) Pretul nu contine TVA
cuTVA: 253.47 RON
Disponibilitate : Sunati
CK20-CM7030-ICRCamera exterior 600 TVL, IR20m Braun Group - CK20-CM7030-ICR

Camera de supraveghere cu infrarosu, senzor CMOS: PC7030, 1/4" 600TVL , IR-CUT    

Pret vechi 74.00 RON
Pret nou
31.80 RON
*) Pretul nu contine TVA
cuTVA: 37.84 RON
Disponibilitate : Sunati
CS-CM138-ICRCamera exterior 1000 TVL, IR25m Braun Group - CS30-CM138-ICR

Camera de supraveghere cu infrarosu, senzor CMOS: SONY IMX238 + FH8520 , with IR-CUT, Color 1/3" SONY CMOS 1000TVL

Pret vechi 136.00 RON
Pret nou
46.30 RON
*) Pretul nu contine TVA
cuTVA: 55.10 RON
Disponibilitate : Sunati
DF-9048RNCamera de supraveghere 480TVL Performer - DF-9048RN

1/3'' sony, 480TVL, 8mm standard lens,6/12mm optional, φ8×40PCS  IR LEDs,40~50m IR distance

Pret vechi 285.34 RON
Pret nou
118.89 RON
*) Pretul nu contine TVA
cuTVA: 141.48 RON
Disponibilitate : Sunati
DI45-CM1099Camera Dome Analogica interior 800 TVL, IR20m Braun Group - DI45-CM1099-ICR

Camera dome analogica de interior de supraveghere cu infrarosu, senzor CMOS: PC1099K, 1/3" 800TVL , IR-CUT, lentila varifocala 2,8-12 mm

Pret vechi 127.00 RON
Pret nou
30.60 RON
*) Pretul nu contine TVA
cuTVA: 36.41 RON
Disponibilitate : Sunati
PE20A-CM138-ICR1000TVL- SONY CMOS Camera , IR30m Braun Group - PE20A-CM138-ICR

Camera dome de supraveghere cu infrarosu , pentru Interior, senzor 1/3" SONY IMX138 + FH8520 , with IR-CUT, CMOS 1000TVL, 1.3Megapixel Sensor, 720P, distanta IR 30m, Lentila 3.6mm

Pret vechi 155.51 RON
Pret nou
42.80 RON
*) Pretul nu contine TVA
cuTVA: 50.93 RON
Disponibilitate : Sunati
Camera de supraveghere tip Dome cu IRCamera de supraveghere tip Dome cu IR Braun Group - EN-DIP30A-ICR

Camera de supraveghere tip Dome cu IR, pentru exterior, 1/3 CMOS 600TVL with IR-Cut Filter CMOS chipset: Pixelplus PC1089K, distanta IR 30m, IP66

Pret vechi 136.96 RON
Pret nou
76.09 RON
*) Pretul nu contine TVA
cuTVA: 90.55 RON
Disponibilitate : Sunati
PT Dome ControllerPT Dome Controller Braun Group - EN-PTRC

PT Dome Controller, Controller+Receiver, RS485 control, poate controla pana la 99 PT dome, greutate: 0.3Kg

Pret vechi 60.00 RON
Pret nou
9.90 RON
*) Pretul nu contine TVA
cuTVA: 11.78 RON
Disponibilitate : Sunati
Camera de supraveghere tip DomeCamera de supraveghere Dome Performer - DF-348RN

1/3'' CCD SONY, 540TVL, lentile varifocale manuale 4~9mm, φ5 x 36 LED-uri IR, distanta IR 25-30m, Waterproof

Pret vechi 282.01 RON
Pret nou
118.89 RON
*) Pretul nu contine TVA
cuTVA: 141.48 RON
Disponibilitate : Sunati
Camera de supraveghere tip Dome DF-342RNCamera de supraveghere Dome Performer - DF-342RN

1/3" sony CCD, 420TVL, lentile varifocale manuale 3.5~8mm, φ5 x 42 LED-uri IR, distanta IR 10-15m

Pret vechi 239.00 RON
Pret nou
30.60 RON
*) Pretul nu contine TVA
cuTVA: 36.41 RON
Disponibilitate : Sunati
Camera de supraveghere IR DF-5802RNCamera de supraveghere IR Performer - DF-5802RN

1/3"sony CCD,420TVL, lentile varifocale manuale 3.5~8mm, φ5×42PCS  LED-uri IR, distanta IR 30m

Pret vechi 252.05 RON
Pret nou
104.62 RON
*) Pretul nu contine TVA
cuTVA: 124.50 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-936RN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3"sony CCD, 420TVL, 6mm standard lens, 6/8/12mm optional, φ8×16PCS  IR LEDs, 20~25m IR distance

Pret vechi 153.13 RON
Pret nou
80.85 RON
*) Pretul nu contine TVA
cuTVA: 96.21 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-5703RN

 Camera Color CCD cu infrarosu, rezistenta la apa, 1/3"sony CCD, 420TVL, 3.5~8mm manual varifocal  lens, φ5×42PCS  IR LEDs, 30m IR distance

Pret vechi 228.00 RON
Pret nou
29.60 RON
*) Pretul nu contine TVA
cuTVA: 35.22 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-A8088RN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3" SONY CCD, 480TVL, Lentile 8mm, φ8×18PCS  IR LEDs, Distanta IR 25~30m

Pret vechi 275.82 RON
Pret nou
142.67 RON
*) Pretul nu contine TVA
cuTVA: 169.77 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-B8082RN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3" SONY CCD, 420TVL, Lentile 8mm, φ8×18PCS  IR LEDs, Distanta IR 25~30m

Pret vechi 172.15 RON
Pret nou
104.62 RON
*) Pretul nu contine TVA
cuTVA: 124.50 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-848SN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3" SONY CCD, 480TVL, Lentile 6mm, φ5×30PCS  IR LEDs, Distanta IR 15~20m

Pret vechi 232.55 RON
Pret nou
90.36 RON
*) Pretul nu contine TVA
cuTVA: 107.52 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video varifocala 9-22mm cu infrarosu rezistenta la apa Performer - DF-5908RN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3"sony CCD, 480TVL, 9~22mm Varifocal l lens, φ5×36PCS  IR LEDs, 40m IR distance

Pret vechi 338.60 RON
Pret nou
137.91 RON
*) Pretul nu contine TVA
cuTVA: 164.12 RON
Disponibilitate : Sunati
Camera supraveghere video cu infrarosu rezistenta la apaCamera supraveghere video cu infrarosu rezistenta la apa Performer - DF-980RN

Camera Color CCD cu infrarosu, rezistenta la apa, 1/3"sony CCD, 420TVL, 6mm standard lens, 8/12mm optional, φ5×30PCS  IR LEDs 25~30m IR distance

Pret vechi 157.89 RON
Pret nou
85.60 RON
*) Pretul nu contine TVA
cuTVA: 101.86 RON
Disponibilitate : Sunati
Camera CCD analogica Color Komida FS602ACamera CCD analogica Color Komida - FS602A

Camera analogica, CCD 1/3" SONY, color, 480 TVL, Lentile 16mm 19°, distanta IR 60m, Led-uri IR 8mm x 36, Weatherproof, grad protectie IP66

Pret vechi 363.00 RON
Pret nou
125.00 RON
*) Pretul nu contine TVA
cuTVA: 148.75 RON
Disponibilitate : Sunati
Camera CCD analogica Color Komida FS202ACamera CCD analogica Color Komida - FS202A

Camera CCD analogica SONY, color, 1/3", Lentile 6mm 53°, IR, distanta IR 20m, Led-uri IR 24x5mm, de exterior, grad protectie IP66

Pret vechi 452.00 RON
Pret nou
114.50 RON
*) Pretul nu contine TVA
cuTVA: 136.26 RON
Disponibilitate : Sunati
Camera CCD analogica Color Komida FS202DCamera CCD analogica Color Komida - FS202D

Camera CCD analogica SONY, 420TVL, color, 1/3", Lentile 6mm 53°, IR, distanta IR 20m, Led-uri IR 35 x 5mm, de exterior, grad protectie IP66

Pret vechi 284.00 RON
Pret nou
76.00 RON
*) Pretul nu contine TVA
cuTVA: 90.44 RON
Disponibilitate : Sunati
Camera CCD analogica Color Komida DZ907Camera CCD analogica Color Komida - DZ907

Camera CCD analogica SONY, 420TVL, Day&Night, interior, color/alb-negru, 1/3", 0.08 Lux (fara lentila)

Pret vechi 180.71 RON
Pret nou
99.87 RON
*) Pretul nu contine TVA
cuTVA: 118.84 RON
Disponibilitate : Sunati
Camera CCD analogica Komida HB505Camera CCD analogica (body only) Komida - HB505

Camera analogica de interior, Alb/Negru CCD SONY,1/3", 0.01Lux, 600TVL, fara lentile

Pret vechi 247.00 RON
Pret nou
109.00 RON
*) Pretul nu contine TVA
cuTVA: 129.71 RON
Disponibilitate : Sunati
Camera color CMOS wireless SHARP Vision WR247091CA_WC131078CACamera color CMOS wireless SHARP Vision - WR247091CA_WC131078CA

Sistem wireless - 2.4G Color (cu Audio ), camera CMOS color 1/3"  si receptor, microfon incorporat pentru functia audio, infrarosu, pentru utilizare in exterior

Pret vechi 389.96 RON
Pret nou
118.89 RON
*) Pretul nu contine TVA
cuTVA: 141.48 RON
Disponibilitate : Sunati
Camera color CMOS wireless SHARP Vision WR247091CA_WC131020CACamera color CMOS wireless SHARP Vision - WR247091CA_WC131020CA

Sistem wireless - 2.4G Color (cu Audio ), camera CMOS color 1/3"  si receptor, microfon incorporat pentru functia audio

Pret vechi 320.05 RON
Pret nou
133.16 RON
*) Pretul nu contine TVA
cuTVA: 158.46 RON
Disponibilitate : Sunati
Camera color CMOS wireless SHARP Vision WR247091CA_WC131013CACamera color CMOS wireless SHARP Vision - WR247091CA_WC131013CA

Sistem wireless - 2.4G Color (cu Audio ), camera CMOS color 1/3"  si receptor, microfon incorporat pentru functia audio

Pret vechi 342.40 RON
Pret nou
142.67 RON
*) Pretul nu contine TVA
cuTVA: 169.77 RON
Disponibilitate : Sunati
Preturile nu contin TVA
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept