Curs valutar


1 EURO = 4.7777 RON  
1 USD = 4.3149 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


 » Camere de supraveghere, camere IP, camere wireless

Camera de supraveghere IP speed dome 2Megapixeli Planet ICA-HM620

Camera de supraveghere IP speed dome 2Megapixeli

Planet - ICA-HM620

Camera de supraveghere IP speed dome, 2Mega-Pixel, IP66, compresie simultana H.264/M-JPEG, 3GPP, Video Output, 2-way Audio, DI/DO, ONVIF

Alte imagini:
Camera de supraveghere IP speed dome 2Megapixeli Planet ICA-HM620
Pret fara TVA:
5,031.78 RON

Pret cu TVA :
5.987,82 RON

Disponibilitate :

Planet ICA-HM620 - 2 Mega-Pixel PoE Plus Speed Dome Internet Camera
Enhanced Security from Wide Area Surveillance
PLANET ICA-HM620 802.3at PoE Plus Speed Dome Network Camera is designed for the most demanding video surveillance applications, with outstanding, full frame rate video in resolutions up to HDTV 1080p and with optical zoom up to 20x. It supports H.264 and M-JPEG compression formats to deliver excellent picture quality in 1080p/720p resolutions at 30/60 frames per second (fps). Incorporating the progressive scan CMOS sensor from Sony, which is specially designed for surveillance applications, the ICA-HM620 performs high quality images even when zooming in for surveillance of a large area. With quick and reliable installation features, the ICA-HM620 is ideal for shopping malls, warehouses, banks, railway stations, airports, parking lots, as well as city and perimeter surveillance.

Full Surveillance during Day & Night
The ICA-HM620 features an automatic, removable infrared-cut filter, which enables the camera to provide color video when there is sufficient light, and black/white video in dark conditions. The camera is able to maintain clear images 24 hours a day.

Exceptional Image quality
Together with powerful image processing attributes like Wide Dynamic Range and 3-Dimension Noise Reduction technology, the ICA-HM620 is able to filter the intense backlight surrounding a subject and remove noises from video signal. Thus, an extremely clear and exquisite picture quality can be produced even under any challenging lighting conditions.
Exceptional Image quality
Exceptional Image quality Advanced Surveillance Management
The ICA-HM620 supports a number of advanced features that increase monitoring flexibility and capabilities, including Auto-Iris for improving the image quality to avoid over exposure, Two-Way audio function, micro SD/SDHC card slot for local storage, and powerful high-speed precision pan/tilt/zoom capabilities. It also has IP66 protecting cover enabling exceptional coverage of large areas and great details when zooming in.
Advanced Surveillance ManagementFlexible Installation and Power Functionality
The ICA-HM620 applies IEEE 802.3at Power over Ethernet Plus to be powered through standard Ethernet RJ-45 cable from PoE sourcing equipment. Therefore, it increases the deployment flexibility, eliminates the need for power cables and reduces installation costs. The ICA-HM620 is ONVIF compliant and interoperable with other brands’ camera in the market. Includes 64-CH central management software, the ICA-HM620 is indisputably the top choice for outdoor reliable and high performance surveillance.
PLANET ICA-HM620 delivers 360 Degree panoramic clear images in various surveillance applications. It can provide identification of objects and people, perfectly for surveillance needs from all aspects. The ICA-HM620 is built with the IP66 protecting cover so it can be installed in most outdoor environments such as railway stations, warehouses, airports, construction sites, public areas and etc. Co-working with PLANET CV3P or CMS (CV3-M256 / CV3-M1024) plus the 3-Axis Joystick (CV3-JS100), the administrator can manage the ICA-HM620 to perform pan & tilt, zoom-in & zoom-out functions from control center or remote site easily and freely.
ICA-HM620 Application
Key Features
• 1/2.8" Sony Progressive Scan CMOS sensor
• 4.7~84.6mm Vari-Focal, Auto-Iris Lens
• 0.04 lux Minimum Illumination at F1.6
• Maximum resolution 1920 x 1080
• 20 x 8 zooming (20X optical, 8X digital) adjustment
• 360 degree continuous PAN, Tilt (-10 ~ 190 degree)
• Preset speed at 5~400 degree/sec, and manual speed 0.5 ~ 90 degree/sec
• Auto White Balance and Auto Electronic Shutter Time (1/30 ~ 1/10k sec)
• Automatic gain control (AGC) for image-intensified
• Removable IR Cut Filter for Day & Night Function

Video / Audio
• H.264 and M-JPEG video compression simultaneously
• Simultaneous multi-stream support
• Max. Resolution 1080P at 30 fps, 720P at 60fps
• 3DNR to improve picture quality at low Lux
• WDR Enhancement to enhance visibility under extremely bright or dark environments
• Two-Way audio support with enhanced audio quality

Network and Configuration
• Compliant with IEEE 802.3at PoE Plus interface for flexible deployment
• Auto MDI/MDI-X supported
• Supports for IPv6 in addition to the standard IP protocol version 4
• RTSP / UPnP / 3GPP / HTTPS protocols selectable
• DDNS and FTP uploading supports more alternatives in surveillance network

Easy Installation & Management
• ONVIF compliant
• 3GPP for 3G mobile remote applications
• Cam Viewer 3 Central management software supported
• Motion Detection feature can monitor any suspicious movement in specific area
• 256 presets, tour is based on presets, in which speed and park time of presets can be set
• Cruise line: 8 group programmable lines, each cruise with 32 presets
• Digital Input / Output for integration with sensors and alarms
• IP66 outdoor protection with heater and fan for operation under rigorous environmental
• Fan and heater with fully automatic intelligent control
Image device Image device
Lens f = 4.7~94mm, F1.6 Auto/Manual-iris/Focus
Mechanical IR Cut Filter
Angle of view (horizontal x vertical):
H: 5.2 ~ 55.2 Degree
V: 2.4 ~ 42.1 Degree
Min Illumination 0.04 Lux (B/W)
0.3 Lux (color)
Effective Pixels 1920 x 1080 pixels
Pan / Tilt / Zoom
Optical Zoom 20x
Digital Zoom 1~8x variable
Pan Degree 0 ~ 360 Degree continuous panning
Tilt Degree -10 ~ 190 Degree
Preset Point 256
Preset Accuracy 0.225 Degree
Preset Speed 5~400 Degree/sec
Sequence 8
Auto Pan 4
Camera Cruise 8
Privacy Mask 16
Proportional Pan & Tilt On / Off (Pan and tilt speed proportional to zoom ratio)
Resume after Power loss Yes
Zone Title 16
Home Function Preset, Sequence, Auto pan, Cruise
Auto Flip Digital / Mechanical / Off
Digital Slow Shutter On / Off
Video Compression H.264 / M-JPEG
Video Resolution 1080P / 720P / VGA / D1
Frame Rate 30/25 fps @ 1080P
60/50 fps @ 720P
Image Setting Auto Electronic Shutter: 1/30 ~ 1/10k sec
Auto White Balance: Auto / Indoor / Outdoor / ATW
AGC: Auto / Manual
3D Digital Noise reduction
Color, sharpness
Mirror / Flip
Privacy Masks
Text, time and date overlay
Streaming Simultaneously multi-profile streaming
Streaming over UDP, TCP, or HTTP
Controllable frame rate and bandwidth
Constant and variable bit rate (M-JPEG / H.264)
Audio Streaming Two-Way Audio
Audio Compression G.711 64kbps, G.726 32kbps, ADPCM, AAC
Microphone External microphone input
Audio Output Adjustable audio output gain
Network and Configuration
Network Standard IEEE 802.3 10Base-T
IEEE 802.3u 100Base-TX
IEEE 802.3at PoE Plus
Security Password protection, IP address filtering, HTTPS encrypted data transmission, user access log
Users 20 clients on-line monitoring at the same time
System Integration
Application Programming Interface Open API for software integration
ONVIF Compliant
Alarm Triggers Intelligent video motion detection and external input
Alarm Events File upload via FTP, Samba to NAS, SD card or email
Notification via email, HTTP, and TCP
External output activation
Audio alerting output
Pre- and post-alarm buffering
Power Requirement AC 24V ± 10% (system & heater)
IEEE 802.3at (system)
Power Consumption 65 W (with heater)
Operating Temperature -45 ~ 50 Degree C (-49 ~ 122 Degree F)
Operating Humidity 10 ~ 90% (non-condensing)
Weight (includes LENS) 2.32 kg
Dimension (Φ x H) 191.97 x 282.11 mm
Protection Class IP66 outdoor classification, built-in fan and heater
Emission CE, FCC
Connectors 10/100Mbps Ethernet, RJ-45
DC power jack
Terminal block for 4 alarm input and 2 output
RS-485 interface for scanners, pan/tilts controller
External MIC input
Audio out
Composite video out
Micro SD/SDHC card (Max 32GB, Class 10)
Factory default reset
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept