Curs valutar

20-Oct-2019

1 EURO = 4.7556 RON  
1 USD = 4.2732 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » Camere de supraveghere video analogice



Camera color CMOS wireless SHARP Vision WR247091CA_WC131078CA

Camera color CMOS wireless

SHARP Vision - WR247091CA_WC131078CA

Sistem wireless - 2.4G Color (cu Audio ), camera CMOS color 1/3"  si receptor, microfon incorporat pentru functia audio, infrarosu, pentru utilizare in exterior



Pret nou fara TVA :
118,89 RON

Pret nou cu TVA :
141,48 RON

Disponibilitate :
Sunati

SHARP Vision - Wireless System - 2.4G Color (With Audio and Waterproof Camera)
Features
 • Weather resistant housing for outdoor applications
 • Audio & Video Out For VCR Recording or TV Monitoring
 • Auto IR trigger under low light condition
 • Infrared LEDs for night vision
 • Built-in Microphone for Audio Function
 
DIMENSIONS
 
Wireless Color CMOS camera application
 
SPECIFICATIONS:
WIRELESS CAMERA
 • Image Device: 1/3" Color CMOS
 • TV System: PAL / NTSC
 • Resolution: 380TV lines
 • Minimum Illumination: 3 Lux/F1.2
 • Voltage: 8V
 • Output Power : 50mW
 • Current Consumption : Max. 100mA
 • Frequency Range : 2.4GHz

WIRELESS RECEIVER
 • Frequency Range : 2.4GHz
 • Voltage: 12V
 • Current Consumption: 350mA
 • Video Output: 1Vp/p
 • S/N Ratio: 38dB
 • Distance: 10m(in the building), 50m(in the open air)
 
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept