Curs valutar


1 EURO = 4.7204 RON  
1 USD = 4.2231 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiac routerraspberry pi 2 model bwirelesstkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvc


 » Placi de retea wireless, Placi PCMCIA wireless, USB wireless

Adaptor USB Wireless Amiko WLN 880

Adaptor USB Wireless Amiko WLN 880

Amiko - WLN-880

  • Operare si instalare usoara
  • Conexiune USB 2.0
  • Banda de frecvente 2.4GHz (2.415~2.484GHz)
  • Compatibil cu standardele iEEE802.11 b/g/n
  • 64/128bit WPA, WPA-PSK, WPA2, WPA2-PSK. TKIP/AES criptare si autentificare
  • Windows XP/ Vista/ 7 / 8, Linux si MAC OS-X
  • Rata de date 150 Mbps
  • Chipset: Ralink RT5370
Alte imagini:
Adaptor USB Wireless Amiko WLN 880

Pret fara TVA:
29.40 RON

Pret cu TVA :
34,99 RON

Disponibilitate :



Wireless Standards:

IEEE 802.11n (draft) IEEE 802.11g IEEE 802.11b

Host Interface:

High speed USB2.0/1.1 interface

Frequency Band:

2.4GHz ISM (Industrial Scientific Medical) Band


Ralink RT5370

Radio Channel:

1 ~ 14 channels (Universal Domain Selection) 



802.11n: BPSK, QPSK, 16QAM with OFDM
802.11g: BPSK, QPSK, 16QAM, OFDM

Data Security:

64 / 128-bit WEP Encryption WPA, WPA-PSK, WPA2, WPA2-PSK. TKIP/AES


Operating Temperature: 0C° to 40C°
Storage Temperature: -20C° to 75C°
Operating Humidity: 10% ~ 90% (Non-Condensing)
Storage Humidity: 5% ~ 95% (Non-Condensing)

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept