Curs valutar


1 EURO = 4.7607 RON  
1 USD = 4.2327 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


 » Wireless Access Point 2.4Ghz/5Ghz


Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan

TP-Link - EAP110

Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan cu controler EAP, alimentare POE (802.3af).

Alte imagini:
Pret: 125.00 RON
*) Pretul nu contine TVA
Disponibilitate :
In stoc



Interfeța 1 Port Fast Ethernet RJ-45 (Suporta PoE Pasiv)
Butoane Reset
Sursă Alimentare Alimentare PoE sau Externă 12VDC / 1A
Consum Energie 7.7 W
Dimensiuni (l x L x H) 180x180x47.5mm
Tip Antenă 2*3dBi Antene interne omnidirecționale
Montare Kit inclus pentru montare pe perete/pe tavan
Physical Security Lock Slot Kensington Lock
Watch Dog Da
Caracteristici Wireless
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecvență 2.4-2.4835GHz
Rată de Semnal 11n: Până la 300Mbps (dinamic)
11g: Până la 54Mbps (dinamic)
11b: Până la 11Mbps (dinamic)
Sensibilitate Receptor 300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER
Putere de Transmisie



Funcții Wireless SSID-uri Multiple (Până la 8 SSIDs)
Radio Wireless Pornit/Oprit
Atribuire automată a canalelor
Putere de transmisie(Reglare putere de transmisie în dBm)
Load Balance
Wireless Schedule
Statistici Wireless bazate pe SSID/AP/Client
Securitate Wireless Autentificare Captive Portal
Filtrare adrese MAC Wireless
Izolare între clienții wireless
Mapare SSID la VLAN
Detectare AP Rogue
Suport 802.1X
64/128/152-bit WEP / WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK
Controller Software EAP Da
Carcasă Da
Alerte Email Da
Control LED Pornit/Oprit Da
Management Control Acces MAC Da
SNMP v1,v2c
System log local/System Log la Distanță Local/la Distanță Local / La distanță
Telnet Da
Management Web-based HTTP/HTTPS
Certificări CE, FCC, RoHS
Conținut Pachet Access Point Gigabit Wireless N 300Mbps cu posibilitate de montare pe tavan
Adaptor Alimentare
Kit Montare
CD Resurse
Ghid pentru instalare rapidă
Cerințe de Sistem Microsoft Windows XP, Vista, Windows 7, 8, 10
Mediu Temperatură de operare: 0℃~40℃,
Temperatură depozitare: -40℃~70℃,
Umiditate de operare: 10%~90% fără condensare
Umiditate depozitare: 5%~90% fără condensare



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept