Curs valutar

14-Oct-2019

1 EURO = 4.7582 RON  
1 USD = 4.3186 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » Wireless Access Point 2.4Ghz/5Ghz



EAP115

Access Point Wireless N 300Mbps

TP-Link - EAP115

Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan

Alte imagini:
EAP115EAP115EAP115





Pret vechi fara TVA :
141,00 RON


Pret nou fara TVA :
119,00 RON

Pret nou cu TVA :
141,61 RON

Disponibilitate :
In stoc

CARACTERISTICI HARDWARE
Interfața 1 Port 10/100 (RJ-45) cu suport PoE IEEE 802.3af
Butoane Reset
Sursa Alimentare Alimentare PoE sau de la sursa externa 12VDC/1.0A
Consum Energie 5W
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 180*180*47.5mm (7.1 x 7.1 x 1.9 in.)
Tip antena Antene interne 2 * 3dBi Omni
Montare Kit de montare pe tavan / perete (inclus)
Physical Security Lock Slot Kensington Lock
Watch Dog Da
CARACTERISTICI WIRELESS
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecvența 2.4-2.4835GHz
Rata de Semnal 11n: Pâna la 300Mbps (dinamic)
11g: Pâna la 54Mbps (dinamic)
11b: Pâna la 11Mbps (dinamic)
Sensibilitate Receptor 300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER
Funcții Wireless SSID-uri Multiple (Pâna la 8 SSID) Emisie Wireless Pornit/Oprit Atribuire automata a canalelor Controlul puterii de transmisie (Reglare putere de transmisie în dBm) QoS(WMM) Limitare banda Restartare programata Emisie wireless programabila Statistici Wireless bazate pe SSID/AP/Client
Securitate Wireless Autentificare Captive Portal Control Acces Filtrare adrese MAC Wireless Izolare între clienții wireless Mapare SSID la VLAN Detectare AP Rogue Suport 802.1X 64/128/152-bit WEP / WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK
Putere de Emisie CE: <20dBm
FCC: <26dBm
MANAGEMENT
Auranet Controller Software Da
Cluster Mode Da
Controller Software EAP  
Alerte Email Da
Control LED Pornit/Oprit Da
Management Control Acces MAC Da
SNMP v1,v2c
System log local/System Log la Distanța Local/la Distanța Local/Remote Syslog
Telnet Da
Management Web-based HTTP/HTTPS
Management VLAN Yes
ALTELE
Certificari CE, FCC, RoHS
Conținut Pachet EAP115 Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan Adaptor alimentare Kit montare Ghid de instalare
Cerințe de sistem Microsoft Windows 10/8/7/Vista/XP
Mediu Temperatura de operare: 0℃~40℃ (32℉~104℉)
Temperatura depozitare: -40℃~70℃ (-40℉~158℉)
Umiditate de operare: 10%~90% fara condensare
Umiditate depozitare: 5%~90% fara condensare

 

CARACTERISTICI HARDWARE

Interfața

1 Port 10/100 (RJ-45) cu suport PoE IEEE 802.3af

Butoane

Reset

Sursa Alimentare

Alimentare PoE sau de la sursa externa 12VDC/1.0A

Consum Energie

5W

Standarde Wireless

IEEE 802.11n, IEEE 802.11g, IEEE 802.11b

Dimensiuni (L x l x H)

180*180*47.5mm (7.1 x 7.1 x 1.9 in.)

Tip antena

Antene interne 2 * 3dBi Omni

Montare

Kit de montare pe tavan / perete (inclus)

Physical Security Lock

Slot Kensington Lock

Watch Dog

Da

 

CARACTERISTICI WIRELESS

Standarde Wireless

IEEE 802.11n, IEEE 802.11g, IEEE 802.11b

Frecvența

2.4-2.4835GHz

Rata de Semnal

11n: Pâna la 300Mbps (dinamic)
11g: Pâna la 54Mbps (dinamic)
11b: Pâna la 11Mbps (dinamic)

Sensibilitate Receptor

300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER

Funcții Wireless

SSID-uri Multiple (Pâna la 8 SSID) Emisie Wireless Pornit/Oprit Atribuire automata a canalelor Controlul puterii de transmisie (Reglare putere de transmisie în dBm) QoS(WMM) Limitare banda Restartare programata Emisie wireless programabila Statistici Wireless bazate pe SSID/AP/Client

Securitate Wireless

Autentificare Captive Portal Control Acces Filtrare adrese MAC Wireless Izolare între clienții wireless Mapare SSID la VLAN Detectare AP Rogue Suport 802.1X 64/128/152-bit WEP / WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK

Putere de Emisie

CE:
<20dBm
FCC:
<26dBm

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept