Curs valutar


1 EURO = 4.7607 RON  
1 USD = 4.2327 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoestabilizator de tensiunez-wavecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightstabilizator trifazicsmartwallmountvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewayterouter wireless routerindustrialplugprizaunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzac routerenergywirelessraftraspberry piaudiovideocable4 contactrcajacksolo802.3atdoor phone720pmetercomutatormicro switchperetemount1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecwdmsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanventrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5inverter22u27u37u42ulcd4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgapatchtrifazicinvertor47usinrepeterw2ventilatiemetalicpigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high quality


 » Wireless Access Point 2.4Ghz/5Ghz


Access Point Wireless N 300Mbps

TP-Link - EAP115

Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan

Alte imagini:
Pret: 141.00 RON
*) Pretul nu contine TVA
Disponibilitate :

Interfață 1 Port 10/100 (RJ-45) cu suport PoE IEEE 802.3af
Butoane Reset
Sursă Alimentare Alimentare PoE sau de la sursă externă 12VDC/1.0A
Consum Energie 5W
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 180*180*47.5mm (7.1 x 7.1 x 1.9 in.)
Tip antenă Antene interne 2 * 3dBi Omni
Montare Kit de montare pe tavan / perete (inclus)
Physical Security Lock Slot Kensington Lock
Watch Dog Da
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecvență 2.4-2.4835GHz
Rată de Semnal 11n: Până la 300Mbps (dinamic)
11g: Până la 54Mbps (dinamic)
11b: Până la 11Mbps (dinamic)
Sensibilitate Receptor 300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER
Funcții Wireless SSID-uri Multiple (Până la 8 SSID) Emisie Wireless Pornit/Oprit Atribuire automată a canalelor Controlul puterii de transmisie (Reglare putere de transmisie în dBm) QoS(WMM) Limitare bandă Restartare programată Emisie wireless programabilă Statistici Wireless bazate pe SSID/AP/Client
Securitate Wireless Autentificare Captive Portal Control Acces Filtrare adrese MAC Wireless Izolare între clienții wireless Mapare SSID la VLAN Detectare AP Rogue Suport 802.1X 64/128/152-bit WEP / WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK
Putere de Emisie CE: <20dBm
FCC: <26dBm
Auranet Controller Software Da
Cluster Mode Da
Controller Software EAP  
Alerte Email Da
Control LED Pornit/Oprit Da
Management Control Acces MAC Da
SNMP v1,v2c
System log local/System Log la Distanță Local/la Distanță Local/Remote Syslog
Telnet Da
Management Web-based HTTP/HTTPS
Management VLAN Yes
Certificări CE, FCC, RoHS
Conținut Pachet EAP115 Access Point Wireless N 300Mbps cu posibilitate de montare pe tavan Adaptor alimentare Kit montare Ghid de instalare
Cerințe de sistem Microsoft Windows 10/8/7/Vista/XP
Mediu Temperatură de operare: 0℃~40℃ (32℉~104℉)
Temperatură depozitare: -40℃~70℃ (-40℉~158℉)
Umiditate de operare: 10%~90% fără condensare
Umiditate depozitare: 5%~90% fără condensare




1 Port 10/100 (RJ-45) cu suport PoE IEEE 802.3af



Sursă Alimentare

Alimentare PoE sau de la sursă externă 12VDC/1.0A

Consum Energie


Standarde Wireless

IEEE 802.11n, IEEE 802.11g, IEEE 802.11b

Dimensiuni (L x l x H)

180*180*47.5mm (7.1 x 7.1 x 1.9 in.)

Tip antenă

Antene interne 2 * 3dBi Omni


Kit de montare pe tavan / perete (inclus)

Physical Security Lock

Slot Kensington Lock

Watch Dog




Standarde Wireless

IEEE 802.11n, IEEE 802.11g, IEEE 802.11b



Rată de Semnal

11n: Până la 300Mbps (dinamic)
11g: Până la 54Mbps (dinamic)
11b: Până la 11Mbps (dinamic)

Sensibilitate Receptor

300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER

Funcții Wireless

SSID-uri Multiple (Până la 8 SSID) Emisie Wireless Pornit/Oprit Atribuire automată a canalelor Controlul puterii de transmisie (Reglare putere de transmisie în dBm) QoS(WMM) Limitare bandă Restartare programată Emisie wireless programabilă Statistici Wireless bazate pe SSID/AP/Client

Securitate Wireless

Autentificare Captive Portal Control Acces Filtrare adrese MAC Wireless Izolare între clienții wireless Mapare SSID la VLAN Detectare AP Rogue Suport 802.1X 64/128/152-bit WEP / WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK

Putere de Emisie



Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept