Curs valutar


1 EURO = 4.7582 RON  
1 USD = 4.3186 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungiga 850nm mc high wualitygeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte


 » Wireless Access Point 2.4Ghz/5Ghz


Access Point TP-LINK CAP300, Wireless N 300Mbps, PoE, montaj tavan

TP-Link - CAP300

300Mbps Wireless N Ceiling Mount Access Point, Qualcomm, 300Mbps at 2.4GHz, 802.11b/g/n, 1 10/100Mbps LAN, 802.3af PoE Supported, Centralized Management(Wireless Controller Supported)

Alte imagini:

Pret vechi fara TVA :
199,80 RON

Pret nou fara TVA :
163,00 RON

Pret nou cu TVA :
193,97 RON

Disponibilitate :
In stoc

Interfaț� Fast Ethernet (RJ-45) Port *1(Support IEEE802.3af PoE)
Butoane Reset, FIT/FAT
Surs� Alimentare PoE or external 9VDC/0.6A power supply
Consum Energie 5W
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Dimensiuni (L x l x H) 7.1 x 7.1 x 1.9 in. (180*180*47.5mm)
Tip anten� Internal 2* 3dBi Omni
Montare Ceiling /Wall Mounting (Kits included)
Physical Security Lock Kensington Lock Slot
Watch Dog Yes
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecvenț� 2.4-2.4835GHz
Rat� de Semnal 11n: Up to 300Mbps(dynamic)
11g: Up to 54Mbps(dynamic)
11b: Up to 11Mbps(dynamic)
Sensibilitate Receptor 300M: -71dBm@10% PER
150M: -75dBm@10% PER
54M: -78dBm@10% PER
11M: -93dBm@8% PER
6M: -92dBm@10% PER
1M: -96dBm@8% PER
Putere de Emisie CE: <20dBm
FCC: <26dBm
Wireless Functions Multiple SSIDs (Up to 8 SSIDs)
Enable/Disable Wireless Radio
Automatic Channel Assignment
Transmit Power Control (Adjust Transmit Power on dBm)
Reboot Schedule
Wireless Schedule
Wireless Statistics based on SSID/AP/Client
Wireless Security Access Control
Wireless Mac Address Filtering
Wireless Isolation Between Clients
WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK
Wireless Functions Multiple SSIDs (Up to 8 SSIDs)
Enable/Disable Wireless Radio
Automatic Channel Assignment
Transmit Power Control (Adjust Transmit Power on dBm)
Reboot Schedule
Wireless Schedule
Wireless Statistics based on SSID/AP/Client
Wireless Functions Multiple SSIDs (Up to 8 SSIDs)
Enable/Disable Wireless Radio
Automatic Channel Assignment
Transmit Power Control (Adjust Transmit Power on dBm)
Reboot Schedule
Wireless Schedule
Wireless Statistics based on SSID/AP/Client
Load Balance
Band Steering
Wireless Security Captive Portal Authentication
Access Control
Mac Address Authentication
Wireless Isolation Between Clients
SSID to VLAN Mapping
WPA / WPA2-Enterprise,WPA-PSK / WPA2-PSK
Certific�ri CE, FCC, RoHS
Conținut Pachet 300Mbps Wireless N Ceiling Mount Access Point CAP300
Power Adapter
Mounting Kits,
Installation Guide
Cerințe de sistem Microsoft Windows 10/8/7/Vista/XP
Mediu Operating Temperature: 0℃~40℃ (32℉~104℉)
Storage Temperature: -40℃~70℃ (-40℉~158℉)
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing


Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept