Curs valutar


1 EURO = 4.7786 RON  
1 USD = 4.2746 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


 » Switch-uri si injectoare PoE

GS-4210-8P2S - front

8-Port 10/100/1000T PoE + 2-Port 100/1000X SFP Management

Planet - GS-4210-8P2S

8-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed Switch

Pret fara TVA:
836.73 RON

Pret cu TVA :
995,71 RON

Disponibilitate :

Planet GS-4210-8P2S - 8-Port 10/100/1000T 802.3at PoE + 2-Port 100/1000X SFP Managed Switch


A Perfect Managed PoE+ Switch with Advanced L2/L4 Switching and Security
PLANET GS-4210-8P2S is a cost-optimized, desktop-size Managed Gigabit PoE+ Switch featuring PLANET intelligent PoE functions to improve the availability of critical business applications. It provides IPv6/IPv4 dual stack management and built-in L2/L4 Gigabit switching engine along with 8 10/100/1000BASE-T ports featuring 36-watt 802.3at PoE+ and 2 additional Gigabit SFP slots. With a total power budget of up to 120 watts for different kinds of PoE applications, it provides a quick, safe and cost-effective Power over Ethernet network solution for small businesses and enterprises.
Built-in Unique PoE Functions for Powered Devices Management
As it is the managed PoE switch for surveillance, wireless and VoIP networks, the GS-4210-8P2S features the following special PoE management functions:
■ PD alive check
■ Scheduled power recycling
■ PoE schedule
■ PoE usage monitoring
Intelligent Powered Device Alive-Check
The GS-4210-8P2S can be configured to monitor connected PD (Powered Device) status in real time via ping action. Once the PD stops working and responding, the GS-4210-8P2S will resume the PoE port power and bring the PD back to work. It will greatly enhance the network reliability through the PoE port resetting the PD’s power source and reducing administrator management burden.
Scheduled Power Recycling
The GS-4210-8P2S allows each of the connected PoE IP cameras or PoE wireless access points to reboot at a specific time each week. Therefore, it will reduce the chance of IP camera or AP crash resulting from buffer overflow.
PoE Schedule for Energy Saving
Under the trend of energy saving worldwide and contributing to environmental protection, the GS-4210-8P2S can effectively control the power supply besides its capability of giving high watts power. The “PoE schedule” function helps you to enable or disable PoE power feeding for each PoE port during specified time intervals and it is a powerful function to help SMBs or Enterprises save power and money. It also increases security by powering off PDs that should not be in use during non-business hours.
PoE Usage Monitoring
Via the power usage chart in the web management interface, the GS-4210-8P2S enables the administrator to monitor the status of the power usage of the connected PDs in real time. Thus, it greatly enhances the management efficiency of the facilities.

Environment-friendly, Smart Fan Design for Silent Operation
The GS-4210-8P2S features a desktop-sized metal housing, a low noise design and an effective ventilation system. It supports the smart fan technology that automatically controls the speed of the built-in fan to reduce noise and maintain the temperature of the PoE switch for optimal power output capability. The GS-4210-8P2S is able to operate reliably, stably and quietly in any environment without affecting its performance.

IPv6 / IPv4 Dual Stack Management
Supporting both IPv6 and IPv4 protocols, the GS-4210-8P2S helps the SMBs to step in the IPv6 era with the lowest investment as its network facilities need not be replaced or overhauled if the IPv6 FTTx edge network is set up. 

Robust Layer 2 Features
The GS-4210-8P2S can be programmed for advanced switch management functions such as dynamic port link aggregation, 802.1Q VLAN and Q-in-Q VLAN, Multiple Spanning Tree protocol (MSTP), loop and BPDU guard, IGMP snooping, and MLD snooping. Via the link aggregation, the GS-4210-8P2S allows the operation of a high-speed trunk to combine with multiple ports, and supports fail-over as well. Also, the Link Layer Discovery Protocol (LLDP) is the Layer 2 protocol included to help discover basic information about neighboring devices on the local broadcast domain.
Efficient Traffic Control
The GS-4210-8P2S is loaded with robust QoS features and powerful traffic management to enhance services to business-class data, voice, and video solutions. The functionality includes broadcast / multicast storm control, per port bandwidth control, IP DSCP QoS priority and remarking. It guarantees the best performance for VoIP and video stream transmission, and empowers the enterprises to take full advantage of the limited network resources.

Powerful Security
PLANET GS-4210-8P2S offers comprehensive IPv4 / IPv6 Layer 2 to Layer 4 Access Control List (ACL) for enforcing security to the edge. It can be used to restrict network access by denying packets based on source and destination IP address, TCP/UDP ports or defined typical network applications. Its protection mechanism also comprises 802.1X port-based user and device authentication, which can be deployed with RADIUS to ensure the port level security and block illegal users. With the protected port function, communication between edge ports can be prevented to guarantee user privacy. Furthermore, Port security function allows to limit the number of network devices on a given port.

Advanced Network Security
The GS-4210-8P2S also provides DHCP snoopingIP source guard and dynamic ARP inspection functions to prevent IP snooping from attack and discard ARP packets with invalid MAC address. The network administrators can now construct highly-secured corporate networks with considerably less time and effort than before.
Friendly and Secure Management
For efficient management, the GS-4210-8P2S is equipped with webTelnet and SNMP management interfaces. With the built-in web-based management interface, the GS-4210-8P2S offers an easy-to-use, platform-independent management and configuration facility. By supporting the standard SNMP, the switch can be managed via any standard management software. For text-based management, the switch can be accessed via Telnet. Moreover, the GS-4210-8P2S offers secure remote management by supporting SSHSSL andSNMP v3 connections which encrypt the packet content at each session.

Flexibility and Long-distance Extension Solution
The two mini-GBIC slots built in the GS-4210-8P2S support SFP auto-detection and dual speed as it features 100BASE-FX and1000BASE-SX/LX SFP (Small Form-factor Pluggable) fiber transceivers to uplink to backbone switch and monitoring center in long distance. The distance can be extended from 550 meters to 2 kilometers (multi-mode fiber) and up to above 10/20/30/40/50/70/120 kilometers (single-mode fiber or WDM fiber). They are well suited for applications within the enterprise data centers and distributions.

Intelligent SFP Diagnosis Mechanism
The GS-4210-8P2S supports SFP-DDM (Digital Diagnostic Monitor) function that can easily monitor real-time parameters of the SFP for network administrator, such as optical output power, optical input power, temperature, laser bias current and transceiver supply voltage.
Physical Port
  • 8 10/100/1000BASE-T Gigabit RJ45 copper ports with 8-port IEEE 802.3at/af PoE injector
  • 2 100/1000BASE-X mini-GBIC/SFP slots

Power over Ethernet
    • Complies with IEEE 802.3at Power over Ethernet Plus, end-span PSE
    • Backward compatible with IEEE 802.3af Power over Ethernet
    • Up to 8 ports of IEEE 802.3af / 802.3at devices powered
    • Supports PoE power up to 36 watts for each PoE port
    • Auto detects powered device (PD)
    • Circuit protection prevents power interference between ports
    • Remote power feeding up to 100 meters
    • PoE management
- Total PoE power budget control- Per port PoE function enable/disable- PoE port power feeding priority- Per PoE port power limitation- PD classification detection- PD alive-check- PoE schedule
Layer 2 Features
    • Prevents packet loss with back pressure (half-duplex) and IEEE 802.3x pause frame flow control (full-duplex)
    • High performance Store and Forward architecture, broadcast storm control, runt/CRC filtering eliminates erroneous packets to optimize the network bandwidth
    • Supports VLAN
- IEEE 802.1Q tagged VLAN- Provider Bridging (VLAN Q-in-Q) support (IEEE 802.1ad)
      - Protocol VLAN
- Voice VLAN- Private VLAN- Management VLAN- GVRP
    • Supports Spanning Tree Protocol
- STP (Spanning Tree Protocol)- RSTP (Rapid Spanning Tree Protocol)- MSTP (Multiple Spanning Tree Protocol)- STP BPDU Guard, BPDU filtering and BPDU forwarding
    • Supports Link Aggregation
    • - IEEE 802.3ad Link Aggregation Control Protocol (LACP)
- Cisco ether-channel (static trunk)
  • Provides port mirror (many-to-1)
  • Loop protection to avoid broadcast loops

Quality of Service
    • Ingress and egress rate limit per port bandwidth control
    • Storm control support
- Broadcast / Unknown unicast / Unknown multicast
    • Traffic classification
- IEEE 802.1p CoS- TOS / DSCP / IP precedence of IPv4/IPv6 packets
  • Strict priority and Weighted Round Robin (WRR) CoS policies

  • Supports IPv4 IGMP snooping v2 and v3
  • Supports IPv6 MLD snooping v1, v2
  • IGMP querier mode support
  • IGMP snooping port filtering
  • MLD snooping port filtering

    • Authentication
- IEEE 802.1X port-based network access authentication- Built-in RADIUS client to co-operate with the RADIUS servers- RADIUS / TACACS+ login user access authentication
    • Access control list
- IPv4 / IPv6 IP-based ACL- MAC-based ACL
    • MAC security
- Static MAC- MAC filtering
  • Port security for source MAC address entries filtering
  • DHCP snooping to filter distrusted DHCP messages
  • Dynamic ARP Inspection discards ARP packets with invalid MAC address to IP address binding
  • IP source guard prevents IP spoofing attacks
  • DoS attack prevention

    • IPv4 and IPv6 dual stack management
    • Switch management interface
- Web switch management- Telnet command line interface- SNMP v1, v2c and v3- SSH and SSL secure access
    • User privilege levels control
    • Built-in Trivial File Transfer Protocol (TFTP) client
    • BOOTP and DHCP for IP address assignment
    • System maintenance
- Firmware upload/download via HTTP / TFTP- Configuration upload / download through web interface- Dual images- Hardware reset button for system reboot or reset to factory default
  • SNTP Network Time Protocol
  • Cable diagnostics
  • Link Layer Discovery Protocol (LLDP) and LLDP-MED
  • SNMP trap for interface link up and link down notification
  • Event message logging to remote Syslog server
  • Four RMON groups (history, statistics, alarms and events)
  • PLANET smart discovery utility
  • Smart fan with speed control


Hardware Specifications
Copper Ports 8 x 10/100/1000BASE-T RJ45 auto-MDI/MDI-X port
SFP/mini-GBIC Slots 2 x 100/1000BASE-X SFP interface
Supports 100/1000Mbps dual mode and DDM
PoE Injector Port 8 ports with 802.3at / af PoE injector function with port-1 to port-8
Switch Architecture Store-and-Forward
Switch Fabric 20Gbps / non-blocking
Switch Throughput@64Bytes 14.88Mpps
Address Table 8K entries
Shared Data Buffer 4.1 megabits
Flow Control IEEE 802.3x pause frame for full-duplex
Back pressure for half-duplex
Jumbo Frame 10K bytes
Reset Button < 5 sec: System reboot
> 5 sec: Factory default
LED PWR, LNK/ACT, PoE-in-use, 1000, fan alert
Power Requirements 100~240V AC, 50/60Hz, auto-sensing
Dimensions (W x D x H) 330 x 155 x 43.5 mm, 1U height
ESD Protection Contact Discharge 4KV DC
Air Discharge 8KV DC
Enclosure Metal
Weight 1687g
Power Consumption / Dissipation 165 watts (max.) / 563 BTU
Fan 1 x smart fan
Power over Ethernet
PoE Standard IEEE 802.3af / 802.3at PoE+ PSE
PoE Power Supply Type End-span
PoE Power Output Per port 52V DC, 36 watts (max.)
Power Pin Assignment 1/2(+), 3/6(-)
PoE Power Budget 120 watts (max.) @ 25 degrees C
100 watts (max.) @ 50 degrees C
PoE Ability PD @ 9 watts 8 units
PoE Ability PD @ 15 watts 8 units
PoE Ability PD @ 30 watts 4 units
Layer 2 Functions
Port Mirroring TX / RX / both
Many-to-1 monitor
VLAN 802.1Q tagged-based VLAN
Up to 256 VLAN groups, out of 4094 VLAN IDs
802.1ad Q-in-Q tunneling
Voice VLAN
Protocol VLAN
Private VLAN (Protected port)
Link Aggregation IEEE 802.3ad LACP and static trunk
Supports 8 groups of 8-port trunk
Spanning Tree Protocol STP, IEEE 802.1D Spanning Tree Protocol
RSTP, IEEE 802.1w Rapid Spanning Tree Protocol
MSTP, IEEE 802.1s Multiple Spanning Tree Protocol
IGMP Snooping IGMP (v2/v3) snooping
IGMP querier
Up to 256 multicast groups
MLD Snooping MLD (v1/v2) snooping, up to 256 multicast groups
Access Control List IPv4/IPv6 IP-based ACL / MAC-based ACL
QoS 8 mapping ID to 8 level priority queues
- Port number 
- 802.1p priority
- 802.1Q VLAN tag
- DSCP field in IP packet
Traffic classification based, strict priority and WRR
Security IEEE 802.1X port-based authentication
Built-in RADIUS client to co-operate with RADIUS server
RADIUS / TACACS+ user access authentication
IP-MAC port binding
MAC filtering
Static MAC address
DHCP Snooping and DHCP Option82
STP BPDU guard, BPDU filtering and BPDU forwarding
DoS attack prevention
ARP inspection
IP source guard
Management Functions
Basic Management Interfaces Web browser / Telnet / SNMP v1, v2c
Firmware upgrade by HTTP / TFTP protocol through Ethernet network
Remote / Local Syslog
System log
LLDP protocol
Secure Management Interfaces SSH, SSL, SNMP v3
RFC 1215 Generic Traps
RFC 1493 Bridge MIB
RFC 2674 Bridge MIB Extensions
RFC 2737 Entity MIB (Version 2)
RFC 2819 RMON (1, 2, 3, 9)
RFC 2863 Interface Group MIB
RFC 3635 Ethernet-like MIB
Standards Conformance
Regulation Compliance FCC Part 15 Class A, CE, LVD
Standards Compliance IEEE 802.3 10BASE-T
IEEE 802.3u 100BASE-TX/100BASE-FX
IEEE 802.3z Gigabit SX/LX
IEEE 802.3ab Gigabit 1000T
IEEE 802.3x flow control and back pressure
IEEE 802.3ad port trunk with LACP
IEEE 802.1D Spanning Tree protocol
IEEE 802.1w Rapid Spanning Tree protocol
IEEE 802.1s Multiple Spanning Tree protocol
IEEE 802.1p Class of Service
IEEE 802.1Q VLAN tagging
IEEE 802.1x Port Authentication Network Control
IEEE 802.1ab LLDP
IEEE 802.3af Power over Ethernet
IEEE 802.3at Power over Ethernet Plus
RFC 791 IP
RFC 1112 IGMP version 1
RFC 2236 IGMP version 2
RFC 3376 IGMP version 3
RFC 2710 MLD version 1
RFC 3810 MLD version 2
Operating Temperature: 0 ~ 50 degrees C
Relative Humidity: 5 ~ 95% (non-condensing)
Storage Temperature: -20 ~ 70 degrees C
Relative Humidity: 5 ~ 95% (non-condensing)
* Specificatiile pot fi schimbate fara preaviz
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept