Curs valutar

19-Oct-2019

1 EURO = 4.7556 RON  
1 USD = 4.2732 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvclte

ANPC

 » Routere wireless



WF2419I

300N Router IPTV -facilitati avansate QoS video streaming pentru surveillance& STB

Netis - WF2419i- IPTV netis

Router MIMO, cu firmware ajuns la generatia 4 si procesor upgradat la viteza de 620Mhz, cu facilitati avansate de prioritizare streaming video si interfata prietenoasa pentru configurare de la PC sau telefon, meniu de configurare si manual in limba romana.
Oferta speciala: 40.00 lei/buc (= pret pt 20 buc ); 38.00lei/ buc (= pret pt 100 buc ); 
IPTV router ( from 4 *RJ45 ports , 2 ports or 1 port can be configurable as IPTV ); flexible wireless speed management
300 Mbps 2T2R Wireless N Router, 2.4GHz,802.11 n/g/b, Built-in 4-port Switch, SPI firewall,Multiple SSID, Qos, WPS Button,autorun utility, 2*5dBi antenna,
IPTV vlans/bridge.
Wireless Modes: AP, WDS, AP+WDS, Repeater, Client, Multiple AP
 DDNS support /PPPoE/VPN Pass, Through Sursa externa:  DC 9V, 0.5A
Pentru detalii tehnice: http://netis-systems.com/en/search/?keyword=2419i&x=0&y=0






Pret vechi fara TVA :
53,00 RON


Pret nou fara TVA :
45,50 RON

Pret nou cu TVA :
54,15 RON

Disponibilitate :
Sunati

Wireless
Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rate                        802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps,9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode AP, WDS, AP+WDS, Repeater, Client, Multiple AP
Wireless Security              64/128-bit WEP,
WPA-PSK/WPA2-PSK (TKIP/AES)
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Hardware
Standards IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX                                          
Interface 1 * 10/100M Auto MDI/MDIX RJ45 WAN port
4 * 10/100M Auto MDI/MDIX RJ45 LAN port
LED SYS,WPS, WAN, LAN1-LAN4
Button Default, WPS
Antenna 2 * external 5dBi antennas
Power Supply DC 9V/500mA(Output)
Dimensions (L xW x H ) 171 x 107 x 28 mm
Weight 185 g
Software
WAN Type                         DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port                   
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain filtering
VPN Pass-through PPTP, L2TP, IPSEC
Others IPTV,DDNS, Static Routing, WOL, Remote Management,
Firmware upgrade, Backup & Restore
Others
Certification            FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing             
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2419I
1 * Quick Installation Guide
1 * 9V/500mA Power Adapter
1 * Ethernet Cable
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept