Curs valutar

11-Dec-2019

1 EURO = 4.7787 RON  
1 USD = 4.3149 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan

ANPC

 » Routere wireless



MW305R

300N Router, 3 antene 5dB

Mercusys - MW305R

Viteza wireless de 300 Mbps este ideala pentru streaming HD, jocuri online și descarcari de fișiere mari. 

Alte imagini:
MW305R
Pret fara TVA:
46.35 RON

Pret cu TVA :
55,16 RON

Disponibilitate :
Sunati

Dimensiuni 169 x 116 x 35 mm​
Interfața 3 Porturi LAN 10/100Mbps
1 Port WAN 10/100Mbps
Butoane Buton WPS/Reset
Alimentare externa 5VDC/0.6A
Antena 3*5dBi Antene Omnidirec�ionale Nedetașabile
Standarde Wireless IEEE 802.11n, IEEE 802.11g, IEEE 802.11b
Frecvența 2.4 - 2.4835GHz
Rata Semnal

11n: Pâna la 300Mbps (dinamic)

11g: Pâna la 54Mbps (dinamic)

11b: Pâna la 11Mbps (dinamic)

Sensibilitate Receptor

270M: -70dBm@10% PER

130M: -74dBm@10% PER

108M: -74dBm@10% PER

54M: -77dBm@10% PER

11M: -87dBm@8% PER

6M: -90dBm@10% PER

1M: -98dBm@8% PER
Certificari CE, ROHS
Conținut Pachet Router Wireless N MW305R
Alimentator
Ghid Instalare Rapida
Cablu Ethernet RJ-45
Mediu Temperatura de operare: 0℃~40℃,
Temperatura depozitare: -40℃~70℃
Umiditate de operare: 10%~90% fara condensare
Umiditate depozitare: 5%~90% fara condensare
Putere de Transmisie <20dBm
Securitate Wireless 64/128/152-bit WEP / WPA / WPA2,WPA-PSK / WPA2-PSK
Funcții Wireless WDS bridge
Tip WAN Dynamic IP/Static IP/PPPoE/L2TP/PPTP
Management

Parental Control

Access control

Local management

Remote management
DHCP Server
Port Forwarding Virtual server, UPnP, DMZ
Dynamic DNS DynDNS、NO-IP
Securitate Firewall IP and MAC address binding
Protocoale IPv4
Rețea Vizitatori 2.4GHz guest network

 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept