Curs valutar


1 EURO = 4.7787 RON  
1 USD = 4.3149 RON  

fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+hdmisolarserverfixas2ip66cutie15002200turnfanvent3g4gmanagementrouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1svcstackingbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlan


 » Routere wireless

WF 2533

300Mbps High Power Router -turbo button, 1000mW, 3 antene 5dB detasab SMA, Mimo technology, 4LAN

Netis - WF2533

Long Range -300 Mbps High Power Wireless N Router, 2.4GHz,  802.11 n/g/b, Built-in 4-port Switch; ABS casing; 3 detachable antennas* 5dB; 1WAN +4LAN
All mode router: AP router, WISP, repeater, AP+WDS bridge , client, 
Compatible with RP-SMA antennas ( 9dB antennas = PA109S/ PA109C)

Turbo button - switch the signal between: normal / enhanced ( high power mode);
Quick setup / multi-langual management page; PSU: 12V/1A

Alte imagini:
WF 2533WF 2533WF 2533WF 2533

Pret vechi fara TVA :
140,28 RON

Pret nou fara TVA :
110,75 RON

Pret nou cu TVA :
131,79 RON

Disponibilitate :

Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 300Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power 20dBm(MAX)
Data Transfer Rates 802.11n:
40MHz(300Mbps, 270Mbps, 240Mbps, 180Mbps, 120Mbps, 90Mbps, 60Mbps, 30Mbps)
20MHz (144Mbps, 130Mbps, 115Mbps, 86Mbps, 57Mbps, 43Mbps, 28Mbps, 14Mbps) (Auto-Sense)
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
(11Mbps, 9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode                        AP, Repeater, AP+WDS, WDS, Client
Wireless Security 64/128-bit WEP,
SSID Broadcast Enable/Disable
Wireless MAC Filtering                     
Standard IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX                      
Interfaces                               1 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port
4 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port
LED Indicators PWR, Turbo,WAN, LAN1-LAN4
(Turbo LED Status: Blue for Normal Power, Red for High Power)
Buttons Turbo, Default, WPS
Antennas 3* 5dBi Detachable Antenna, SMA Connector
Power Supply DC 12V/1A (Output)                                                                                                                                      
WAN Type                                 DHCP, Static IP, PPPoE, L2TP, PPTP, Dual Access, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port                                                                        
QoS WMM, Bandwidth Control
Access Control IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec
Others Multiple SSID, Dynamic DNS, Static Routing, WOL
Certification FCC, CE
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1 * WF2533
1 * 12V/1A Power Adapter
1 * Ethernet Cable
1 * Quick Installation Guide(Multilingual)
Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept