Curs valutar

13-Nov-2019

1 EURO = 4.7635 RON  
1 USD = 4.3251 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoez-wavestabilizator de tensiunecablu utpswitch cu managementcabinetgigabitstatie radiostatie radio autostatie radio cb19"rackapceilingtavancamerasfpplanetpolitatemperaturesensorhumidityantene satelitlightwallmountstabilizator trifazicsmartvu+ahdhikvisionturbohdtvifibarocontrollersnmppdushelfgatewaywirelessterouter wireless routerindustrialplugprizaac routerraspberry piaudiovideocable4 contactrcajackunifiraspberry pi 2 model btkb4kamiko3kmxsfpddmmountableantene 24ghzenergyraftsolo802.3atdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000rtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+10ghdmisolarserverfixas2ip66cutie15002200turnfanvent3g4grouter gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcabluinoxsirendoor lockcomboa4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemaleethernetmiraextenderom1baterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgascoaxialtvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcisplitergigahd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmsvcltecasetacyberpower

ANPC

 » Wireless Access Point 2.4Ghz/5Ghz



WF-2501

150N High Power Long Range (3x) router 500mW, 7dB detachable antenna

Netis - WF2501

150 Mbps Wireless N High Power Router/ Access Point 500mW, Long Range Router/ extender, 5dBi antenna;

 

Alte imagini:
wf2501 frontWF-2501





Pret vechi fara TVA :
75,90 RON


Pret nou fara TVA :
59,50 RON

Pret nou cu TVA :
70,81 RON

Disponibilitate :
Sunati

DL4102 DL4102 WF2503 WF2503 WF2117 WF2117
 
WF2501P
 
What it does
 
The netis 150Mbps Wireless N Long Range Router WF2501P provides you long range, high performance wireless Internet access over large areas. With the power amplifier ability, you will enjoy excellent network experience in large homes, multi-floor offices or warehouses.
 
Wireless
Standards IEEE 802.11b, IEEE 802.11g, IEEE 802.11n
Signal Rate Up to 150Mbps
Frequency Range 2.4-2.4835GHz
Transmit Power US 23dBm(MAX); EU 20dBm(MAX)
Data Transfer Rate                           802.11n:
40MHz (150Mbps, 135Mbps, 120Mbps, 90Mbps, 60Mbps, 45Mbps, 30Mbps, 15Mbps)
20MHz (72Mbps, 65Mbps, 57Mbps, 43Mbps, 28Mbps, 21Mbps, 14Mbps, 7Mbps)
801.11g:
(54Mbps, 48Mbps, 36Mbps, 24Mbps, 18Mbps, 12Mbps, 11Mbps, 9Mbps, 6Mbps)
802.11b:
(11Mbps, 9Mbps, 6Mbps, 5.5Mbps, 2Mbps, 1Mbps)
Wireless Mode                                      AP, Repeater, AP+WDS, WDS, Client
Wireless Security     64/128-bit WEP,
WPA-PSK/WPA2-PSK (TKIP/AES)
SSID Broadcast Enable/Disable
Wireless MAC Filtering
Hardware
Standards                  IEEE 802.3 10Base-T, IEEE 802.3u 100Base-TX
Interface 1 * 10/100Mbps Auto MDI/MDIX RJ45 WAN port, Passive PoE Supported
4 * 10/100Mbps Auto MDI/MDIX RJ45 LAN port            
LED Indicators SYS, WPS, WAN, LAN1, LAN2, LAN3, LAN4
Buttons WPS, Default
Antenna 1* 5dBi Detachable Antenna, SMA Connector
Power Supply DC 9V/500mA (Output)
Software
WAN Type DHCP, Static IP, PPPoE, WISP
Port Forwarding Virtual Servers, Port Triggering, UPnP, DMZ, FTP Private Port
QoS WMM, Bandwidth Control
Access Control               IP/MAC/Domain Filtering
VPN Pass-through PPTP, L2TP, IPSec                
Others Multiple SSID, Bandwidth Control, Dynamic DNS, Static Routing, WOL
Others
Certification            FCC, CE,
Environment Operating Temperature: 0℃~40℃
Storage Temperature: -40℃~70℃
Operating Humidity: 10%~90% non-condensing
Storage Humidity: 5%~90% non-condensing
Package 1* WF2501P
1* 9V/500mA Power Adapter
1* PoE Power Injector
1* Ethernet Cable
1* Quick Installation Guide
  (Multilingual)

 

 How to Configure AP+WDS Mode (radio-bridge)  on netis WF2501 http://netis-systems.com/en/FAQ/1180.html 

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept