Curs valutar

05-Jun-2020

1 EURO = 4.8393 RON  
1 USD = 4.2695 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpgigabitz-wavestabilizator de tensiuneswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapsfpceilingtavancameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtviindustrialpdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerplugprizaraspberry piaudiovideocable4 contactrcajackamikoac routerunifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxvflsmbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9twin

ANPC
  • Comenzi online rapide
  • UPS Braun Group
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM

ANUNT PENTRU TOTI CLIENTII - MASURI PROTECTIE impotriva CORONAVIRUS

  • Magazinele noastre sunt in continuare deschise pentru clienti, cu respectarea legilor si ordonantelor in vigoare.
  • Rugam clientii sa aiba masca, manusi si sa pastreze distanta de 2 metri.
    Multumim pentru intelegere.
 
Pagini produse: 1234567
ML7200

282.84 RON
pret fara TVA
cuTVA: 336.57 RON
Antena satelit offset OUBIX
72.43 RON
fara TVA
49.86 RON
pret fara TVA
cuTVA: 59.34 RON
Antene satelit offset OUBIX
223.85 RON
fara TVA
137.92 RON
pret per bucata
pret fara TVA
cuTVA: 164.12 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
29.71 RON
fara TVA
18.04 RON
pret per bucata
pret fara TVA
cuTVA: 21.46 RON
SATTRACKER

338.43 RON
pret fara TVA
cuTVA: 402.73 RON
Receptor de cablu Amiko HD 8142 TWIN C

179.00 RON
pret fara TVA
cuTVA: 213.01 RON
Vu+ DUO 4K

1,591.35 RON
pret fara TVA
cuTVA: 1,893.71 RON
TF7720
563.34 RON
fara TVA
265.23 RON
pret fara TVA
cuTVA: 315.62 RON
HD8265
240.82 RON
fara TVA
225.97 RON
pret fara TVA
cuTVA: 268.91 RON
Amiko Mira WiFi
175.05 RON
fara TVA
136.86 RON
pret fara TVA
cuTVA: 162.86 RON
Amiko Mira
159.14 RON
fara TVA
126.25 RON
pret fara TVA
cuTVA: 150.23 RON
Amiko A5 combo
549.55 RON
fara TVA
466.80 RON
pret fara TVA
cuTVA: 555.49 RON
Receptor Terestrial Amiko T60 T2

78.40 RON
pret fara TVA
cuTVA: 93.30 RON
VU Plus Uno 4K SE
1,426.91 RON
fara TVA
1,175.48 RON
pret fara TVA
cuTVA: 1,398.82 RON
Receptor de satelit digital VU Plus Zero4 K
660.94 RON
fara TVA
620.63 RON
pret fara TVA
cuTVA: 738.54 RON
AMIKO A4 COMBO
434.97 RON
fara TVA
372.38 RON
pret fara TVA
cuTVA: 443.13 RON
ML6200S
316.15 RON
fara TVA
232.34 RON
pret fara TVA
cuTVA: 276.48 RON
ML6500STC
392.53 RON
fara TVA
317.21 RON
pret fara TVA
cuTVA: 377.48 RON
Vu+ Solo SE V2
826.44 RON
fara TVA
458.31 RON
pret fara TVA
cuTVA: 545.39 RON
ML-1100S
189.90 RON
fara TVA
102.49 RON
pret fara TVA
cuTVA: 121.96 RON
Vu+ Solo4K
1,425.85 RON
fara TVA
1,335.67 RON
pret fara TVA
cuTVA: 1,589.45 RON
ML-4100T2C
244.01 RON
fara TVA
185.66 RON
pret fara TVA
cuTVA: 220.93 RON
Pagini produse: 1234567

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept