Curs valutar

28-Feb-2020

1 EURO = 4.8068 RON  
1 USD = 4.3926 RON  

Etichete
fibra opticaswitchrouterrouter wirelessswitch gigabitpoecablu utpz-wavestabilizator de tensiunegigabitswitch cu managementcabinetstatie radiostatie radio autostatie radio cb19"rackapceilingtavansfpcameraplanetpolitatemperaturesensorhumidityantene satelitlightsmartwallmountstabilizator trifazicvu+ahdhikvisionturbohdtvipdufibarocontrollersnmpshelfgatewaywirelessterouter wireless routerindustrialplugprizaraspberry piaudiovideocable4 contactrcajackac routeramikounifiraspberry pi 2 model btkb4k3kmxsfpddmmountableantene 24ghz802.3atenergyraftsolo10gdoor phone720pmetercomutatormicro switchperetemountwdm1000mswitch poeinjectormobila3000ventrtl8370-grconectorconectorirapidelectricdateelectricicablu ftpraspberrygertduinoarduinoaeotecsfp+combohdmisolarserverfixas2ip66cutie15002200turnfan3g4gmanagementrg6router gigabitvu+ tuner dvb-c/t/t2raspberry pi 2 model b+ kitgiga 850nm mc high wualityraspberry pi 3 model bsippopprazberry100mhdcablucoaxialinoxsirendoor locka4fbcstacking sfpcat5patchinverter22u27u37u42ulcdmetalic4ksemeshoutdoor650ups120060001000010kvaepscentrala5ghzfemalegigaethernetmiraextenderom1svcstackingcoaxbaterielaptopdelld630d-630acumulatorbanana pibanana provu+ solo2vu+ duo2duo 2duo2ab cryptobox 600hdcablu alimentarebalungeponusb stickwifipirmotionvideo interfonvera plusgastvcamewradvr4ch150mftpmonturadoor sensorwindow sensormicroswitchflood sensorsmoke sensorrelay switchrgbwdimmerwallsocketblindunotesterconvertortermostatplcvgatrifazicinvertor47usinrepeterw2ventilatiepigtailapcsasiu60085010501300sinus900gamingusb20kva1000ftthwmt60pcispliterhd826548pl80l45l60repetorfast750giga 850nm mc high qualitymetalac1200litatstrandedom1.m0148vtelefonic20kmltecasetacyberpowervlanean:f669lsnhbg0530w12v7ah12v9

ANPC
  • UPS Braun Group
  • Cyber Power
  • Cyber Power
  • TP-Link
  • IP-COM
  • Planet
  • NETIS
  • Cabluri Belden
  • IP-COM
  • IP-COM
Pagini produse: 1234567
ML7200

274.60 RON
pret fara TVA
cuTVA: 326.77 RON
Antena satelit offset OUBIX
70.32 RON
fara TVA
48.41 RON
pret fara TVA
cuTVA: 57.61 RON
Antene satelit offset OUBIX
217.33 RON
fara TVA
133.90 RON
pret per bucata
pret fara TVA
cuTVA: 159.34 RON
LNC cu feed pentru antene offset Opticum ALPS-Single
28.84 RON
fara TVA
17.51 RON
pret per bucata
pret fara TVA
cuTVA: 20.84 RON
SATTRACKER

328.57 RON
pret fara TVA
cuTVA: 391.00 RON
Vu+ DUO 4K

1,545.00 RON
pret fara TVA
cuTVA: 1,838.55 RON
TF7720
546.93 RON
fara TVA
257.50 RON
pret fara TVA
cuTVA: 306.43 RON
HD8265
233.81 RON
fara TVA
219.39 RON
pret fara TVA
cuTVA: 261.07 RON
Amiko Mira WiFi
169.95 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
Amiko Mira
154.50 RON
fara TVA
122.57 RON
pret fara TVA
cuTVA: 145.86 RON
Amiko A5 combo
533.54 RON
fara TVA
453.20 RON
pret fara TVA
cuTVA: 539.31 RON
Receptor Terestrial Amiko T60 T2

76.12 RON
pret fara TVA
cuTVA: 90.58 RON
VU Plus Uno 4K SE
1,385.35 RON
fara TVA
1,141.24 RON
pret fara TVA
cuTVA: 1,358.08 RON
Receptor de satelit digital VU Plus Zero4 K
641.69 RON
fara TVA
602.55 RON
pret fara TVA
cuTVA: 717.03 RON
AMIKO A4 COMBO
422.30 RON
fara TVA
361.53 RON
pret fara TVA
cuTVA: 430.22 RON
ML6200S
306.94 RON
fara TVA
225.57 RON
pret fara TVA
cuTVA: 268.43 RON
ML6500STC
381.10 RON
fara TVA
307.97 RON
pret fara TVA
cuTVA: 366.48 RON
Vu+ Solo SE V2
802.37 RON
fara TVA
444.96 RON
pret fara TVA
cuTVA: 529.50 RON
ML-1100S
184.37 RON
fara TVA
99.50 RON
pret fara TVA
cuTVA: 118.41 RON
Vu+ Solo4K
1,384.32 RON
fara TVA
1,296.77 RON
pret fara TVA
cuTVA: 1,543.16 RON
ML-4100T2C
236.90 RON
fara TVA
180.25 RON
pret fara TVA
cuTVA: 214.50 RON
USB-RJ45
204.97 RON
fara TVA
132.87 RON
pret fara TVA
cuTVA: 158.12 RON
Pagini produse: 1234567

Utilizăm cookie-uri pentru a îmbunătăți experiența site-ului și pentru a analiza traficul și publicul pe site. Continuând să navigați pe site-ul nostru, sunteți de acord cu acceptarea utilizării cookie-urilor în conformitate cu Politica de utilizare a cookie-urilor, de acord cu Politica de prelucrare a datelor personale și ați notat Notă de procesare a informațiilor personale. Accept